SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019472 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019472
Domain Number 1 Region: 424-684
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.62e-76
Family Eukaryotic proteases 0.0000000338
Further Details:      
 
Domain Number 2 Region: 26-135
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-30
Family Spermadhesin, CUB domain 0.00000106
Further Details:      
 
Domain Number 3 Region: 185-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-28
Family Spermadhesin, CUB domain 0.00000271
Further Details:      
 
Domain Number 4 Region: 366-436
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000292
Family Complement control module/SCR domain 0.0000164
Further Details:      
 
Domain Number 5 Region: 299-369
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000403
Family Complement control module/SCR domain 0.0001
Further Details:      
 
Domain Number 6 Region: 134-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000197
Family EGF-type module 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019472   Gene: ENSECAG00000021756   Transcript: ENSECAT00000023503
Sequence length 686
Comment pep:known chromosome:EquCab2:2:40427600:40443898:1 gene:ENSECAG00000021756 transcript:ENSECAT00000023503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLLIFLGLLWGSAAGAPGLQWPKPVFGRLASPGFPGEYANNQERHWTLTAPPGYRLRLYF
THFHLELSYLCEYDFVKLSSGTKVLATLCGWESTDTELAPGNDTFYSPGSSLDVTFHSDY
SNEKPFTGFEAFYAAEDIDECQVPPGEAPPCDHHCHNHLGGFYCSCRVGYVLHQNKRTCS
ALCLGQVFTDRSGVISSPEYPQPYPKLSSCTYSIHLEEGFSIILNFVESFNVEMHPEIQC
PYDSLKIQTDKAEYGPFCGDTLPGRIETKSNIVTITFVTDQSGDHAGWKIHYSSTARPCP
DPTAPPNGHITPVQATYILKDSFSVFCKTGYELLQGGYLPLKSFAAVCQKDGSWDQPMPE
CSVVDCGPPDHLPSGRVEHLTGPEATTYKAEIQYHCNETFYTMTTNDGKYVCEADGFWTS
SKGEKSLPICEPVCGKSTRTTRGRIHGGQNAKLGDFPWQVLLLGEATAAGALLYDKWILT
AAHAVYGQREDASSLDIRMGALKRLSPHYTQAWAEAIFIHEDYNHDTGFDNDIALIKLKN
KVVINSNILPICLPRKEAESFMRTDDIGTAAGWGLTERGFLARNLKFVDIPVVDHQKCTA
AYEKKPYPGGRVTGNMLCAGLESGGKDSCKGDSGGALVFLDNETQTWFVGGIVSWGSINC
GEAHQYGVYTKVINYIPWIKNIIDNF
Download sequence
Identical sequences F6YAM5
ENSECAP00000019472 9796.ENSECAP00000019472 ENSECAP00000019472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]