SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019662 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019662
Domain Number 1 Region: 6-167
Classification Level Classification E-value
Superfamily E set domains 1.96e-55
Family RhoGDI-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019662   Gene: ENSECAG00000022266   Transcript: ENSECAT00000023718
Sequence length 171
Comment pep:known chromosome:EquCab2:8:13489759:13495392:-1 gene:ENSECAG00000022266 transcript:ENSECAT00000023718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDYLCKPEDNVYSIDFTRFKIRDLETGTVLFEIAKPYVSDQEEEEEEEGGDVDISAGRFV
RYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFRERLLKNFDFDFGFCIPSSRNT
CEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLIMHNKADYAYNGGQ
Download sequence
Identical sequences F6YV70
ENSECAP00000019662 ENSECAP00000019662 9796.ENSECAP00000019662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]