SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019703 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019703
Domain Number 1 Region: 626-925
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-83
Family Protein kinases, catalytic subunit 0.000000000718
Further Details:      
 
Domain Number 2 Region: 32-204
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-74
Family Ephrin receptor ligand binding domain 0.000000906
Further Details:      
 
Domain Number 3 Region: 331-537
Classification Level Classification E-value
Superfamily Fibronectin type III 4.24e-42
Family Fibronectin type III 0.00007
Further Details:      
 
Domain Number 4 Region: 920-995
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.59e-22
Family SAM (sterile alpha motif) domain 0.00028
Further Details:      
 
Domain Number 5 Region: 260-322
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000115
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019703   Gene: ENSECAG00000021315   Transcript: ENSECAT00000023759
Sequence length 998
Comment pep:known chromosome:EquCab2:10:45216273:45383965:-1 gene:ENSECAG00000021315 transcript:ENSECAT00000023759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFQTRHPSWIILCYISLLRFAHTGDAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISG
LDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCK
ETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKK
GFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEE
EAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHS
FSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGR
NDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNG
VSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKY
YEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATG
KMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHF
KFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDV
AVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALD
AFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLS
RVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDM
SNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSL
KTPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTI
EDVMSLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV
Download sequence
Identical sequences F6Z105
XP_001503840.1.31192 XP_008519652.1.77740 XP_014706385.1.49734 ENSECAP00000019703 9796.ENSECAP00000019703 ENSECAP00000019703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]