SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019772 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019772
Domain Number 1 Region: 621-1034
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 8.16e-91
Family alpha-mannosidase, C-terminal domain 0.034
Further Details:      
 
Domain Number 2 Region: 250-517
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.45e-85
Family alpha-mannosidase 0.0099
Further Details:      
 
Domain Number 3 Region: 518-619
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 2.55e-24
Family alpha-mannosidase, domain 2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000019772
Domain Number - Region: 77-150
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00255
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019772   Gene: ENSECAG00000021864   Transcript: ENSECAT00000023838
Sequence length 1039
Comment pep:known chromosome:EquCab2:1:118571637:118583395:1 gene:ENSECAG00000021864 transcript:ENSECAT00000023838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMAAAPALKHWRTTLERVEKFVSPLYFTDCNLRGRLFGDSCPVAALSSFLTPERLPYQE
AVQQDFRPAQVGDSFGPTWWTCWFRVELTIPEAWVGQEVHLRWESDGEGLVWRDGEPVQG
LTKEGEKTSYVLTDRLGEGDPRSMTLYVEVACNGLLGAGKGTMIAAPDPEKMFQVSRAEL
AVFHQDVHKLLVDLELLLGMAKGLGEDNQRSFQALYTANQIVNVCDPAQPETFPVAQALA
SKFFGQRGGESQHTIHAMGHCHIDTAWLWPFKETVRKCARSWVTAVQLMEQNPEFIFVCS
QAQQLEWVKSHYPGLHAQLQEFACRGQFVPVGGTWVEMDGNLPSGEAMVRQFLQGQNFFL
QEFGKMCSEFWLPDTFGYSAQLPQIMRSCGIRHFLTQKLSWNLVNSFPHHTFFWEGLDGS
RVLAHFPPGDSYGMQGSVEEVLKTVTKNQDKGRTNHSAFLFGFGDGGGGPTQTMVDRLKR
LRNTDGLPRVQLSSPGQLFSALESDSGQLCTWVGELFLELHNGTYTTHAQIKKGNRECER
ILHDVELLSSLALARSAHFLYPAAQLQDLWRLLLLNQFHDVVTGSCIQLVAEEAMCHYED
IRSHGNTLLSAAAAALCAGEPGPKGLLIVNTLPWKRTEVLALPRPGGAHSLALVTVPSMG
YAPAPAPTSLQPLLPQQPVFVVQETDGSVTLDNGIIRVRLDPTGCLTSLVLVASGREAIA
EGTVGNQFVLFDDVPLYWDAWDVMDYHLETRKPVLGQAGTLAVGTEGGVRGSAWFLLQIS
ANSRLSQEVVLDVGCPYVRFHTEVHWHEAHKFLKVEFPARVRSPQATYEVQFGHLQRPTH
YNTSWDWARFEVWAHRWMDLSEHGFGLALLNDSKYGASVRGSVLSLSLLRAPKAPDATAD
MGRHEFTYALMPHEGSFQDAGVIRAAYSVNFPLLALPTPGPAPAAAWSAFSVSSPAVVLE
TAETSPQGRTLVLRLYEAHGSHVDCWLHTSLPVQEAVLCDLLERRDPAGHLPLRDARLKL
TFSPFQVRSLLLVLQPPPN
Download sequence
Identical sequences F6YTG8
9796.ENSECAP00000019772 ENSECAP00000019772 ENSECAP00000019772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]