SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019842 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019842
Domain Number 1 Region: 50-130
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000173
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.006
Further Details:      
 
Domain Number 2 Region: 326-372
Classification Level Classification E-value
Superfamily RING/U-box 0.00000013
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 269-305
Classification Level Classification E-value
Superfamily SAP domain 0.0000168
Family SAP domain 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000019842
Domain Number - Region: 117-127,217-241
Classification Level Classification E-value
Superfamily ARM repeat 0.0449
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019842   Gene: ENSECAG00000022379   Transcript: ENSECAT00000023915
Sequence length 378
Comment pep:known chromosome:EquCab2:8:21809966:21930517:1 gene:ENSECAG00000022379 transcript:ENSECAT00000023915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAGATSMWASCCGLLNEVMGTGAVRGQQSGFAGGTGPFRFTPNSDFSTYPPAPTEGPNI
VCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKV
KDLRQYLILRNIPIDTCREKEDLVDLVLCHHGLGSEDDLDTSSLNSSRSQTSSFFTHSFF
SNYTAPSATVSSFQGELMGGDRTLGSGALAQVQSEVASANTEDDDDDDDDDDDEEDEDED
DEGNLEERTPGLSKKRVRASLSDLSSLDDVEGMSVRQLKEILARNFVNYSGCCEKWELVE
KVNRLYKENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMS
ECPICRQYVVRAVHVFKS
Download sequence
Identical sequences F7BRD7
9796.ENSECAP00000019842 ENSECAP00000019842 ENSECAP00000019842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]