SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019892 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019892
Domain Number 1 Region: 27-128
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000187
Family Filamin repeat (rod domain) 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019892   Gene: ENSECAG00000022335   Transcript: ENSECAT00000023970
Sequence length 502
Comment pep:known chromosome:EquCab2:17:71346738:71360289:-1 gene:ENSECAG00000022335 transcript:ENSECAT00000023970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSVLLLYCFFLGTVPALAETGGERRLSPEKSEIWGPGLKAAVVLPARYFYIQAVDTSGN
KFTSSPGEKVFQIKISAPDEQFTRVGVQVLDRKDGSFIVRYRMYASYKNLKVEVKFQGQH
VAKSPYILKGPVYHENCDCPLEDSAAWLQEMSCPETITQIQRDLAHFPTVDPEKIATEIP
KRFGQRQSLCHYTLKDNKVYIKTHGEHVGFRIFMDAILLSLTRKVKMPDAEFFVNLGDWP
LEKKKSSSHIHPIFSWCGSTDSKDIVMPTYDLTDSVLETMGRVSLDMMSVQGNTGPPWES
KNSTAVWRGRDSRKERLELVKLSRKHPELIDAAFTNFFFFKHDESLYGPIVKHISFFDFF
KHKYQINVDGTVAAYRLPYLLVGDSVVLKQDSIYYEHFYNELQPWKHYIPVKSNLSDLLE
KLKWAKDHDEEAKKIAKAGQEFARNNLMGDDIFCYYFKLFQEYASLQVSEPQIREGMKRV
EPQTEDDLFPCTCHRKQTKDEL
Download sequence
Identical sequences F7BK32
ENSECAP00000019892 9796.ENSECAP00000019892 XP_001493278.1.31192 XP_008532125.1.77740 ENSECAP00000019892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]