SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019916 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019916
Domain Number 1 Region: 64-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000787
Family EGF-type module 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019916   Gene: ENSECAG00000022505   Transcript: ENSECAT00000024002
Sequence length 178
Comment pep:known chromosome:EquCab2:3:61095652:61247843:1 gene:ENSECAG00000022505 transcript:ENSECAT00000024002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRAAPGSSASSLPLLLALALGLVILHCVVADGNSTRSPENDGLLCGDPRENCAATTTQS
KRRGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYAGARCERVDLFYLRGDRGQIL
VICLIAIMVIFIILVVSICTCCHPLRKRRKRRKKEEEMETLGKDITPINEDIQETSIA
Download sequence
Identical sequences F7B8P3
ENSECAP00000019916 XP_005608767.1.31192 XP_008520177.1.77740 XP_014720606.1.49734 9796.ENSECAP00000019916 ENSECAP00000019916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]