SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019961 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019961
Domain Number 1 Region: 129-373
Classification Level Classification E-value
Superfamily vWA-like 1.35e-85
Family Integrin A (or I) domain 0.0000000462
Further Details:      
 
Domain Number 2 Region: 371-458
Classification Level Classification E-value
Superfamily Integrin domains 3.45e-24
Family Integrin domains 0.00028
Further Details:      
 
Domain Number 3 Region: 622-705
Classification Level Classification E-value
Superfamily Integrin beta tail domain 3.4e-18
Family Integrin beta tail domain 0.001
Further Details:      
 
Domain Number 4 Region: 21-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000413
Family Plexin repeat 0.001
Further Details:      
 
Domain Number 5 Region: 580-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000276
Family Integrin beta EGF-like domains 0.0017
Further Details:      
 
Domain Number 6 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000223
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Domain Number 7 Region: 80-154
Classification Level Classification E-value
Superfamily Integrin domains 0.00000502
Family Integrin domains 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000019961
Domain Number - Region: 507-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family Integrin beta EGF-like domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019961   Gene: ENSECAG00000021969   Transcript: ENSECAT00000024051
Sequence length 788
Comment pep:known chromosome:EquCab2:18:40789560:40860803:-1 gene:ENSECAG00000021969 transcript:ENSECAT00000024051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIELLCLFFLFLGRNDRVQGGCAVGGAETCEDCLLTGPQCAWCSQENFTHPSGVGERCD
SPANLLAKGCQLSFIENPVSQVEILTNKPLSVGRQKNSSNIVQISPQSLTLKLRPGIEQT
LQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSLLSKEMSKLTSNFRLGFGSFVEK
PVSPFMKTSPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFPHQKKCSHMKVGDTASFNVT
VSIPNCERRSRHIIIKPVGLGDALEILVSPECDCDCQKEVEVNSSKCHNGNGSFQCGVCA
CNPGHMGPRCECGEDMLSTDSCKEAPDLPSCSGRGDCYCGQCICHLSPYGNIYGPFCQCD
NFSCVRHKGLLCGDHGDCDCGECVCKSGWTGEYCNCTTSTDSCVSEDGVLCSGRGDCICG
KCVCTNPGASGPTCERCPTCGDPCNSKRSCIECYLSADGQAREECVDKCKLAGATINEEE
DFSKDSSVSCSLQGENECLITFLITTDNEGKTIIHSISEKDCPKPPNIPMIMLGVSLAIL
LIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHSEKQ
KLALSTDG
Download sequence
Identical sequences F7B3K7
9796.ENSECAP00000019961 ENSECAP00000019961 ENSECAP00000019961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]