SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019991 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019991
Domain Number 1 Region: 136-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000014
Family EGF-type module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019991   Gene: ENSECAG00000022525   Transcript: ENSECAT00000024083
Sequence length 247
Comment pep:known chromosome:EquCab2:3:61374032:61381837:-1 gene:ENSECAG00000022525 transcript:ENSECAT00000024083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPLLPPAPVVLSLLILGSAHYAAGLDVNDTYSGKEEPFSGDHSADGFEVTSGSEISPV
SEMPSSSELPLGLDYDYEEEYDNEPQISGYIVDDSIRVEQVVKPKKNKTESEKTSDKPKR
KKKGGKNGKNRRNKKKKNPCDAEFQNFCIHGECKYIEHLEAVTCQCHQDYFGERCGEKSM
KTHSMVDSNLSKIALAAIAAFVSAVSFTALAVVITIRLRKRYFRHCEGEAEERKKLRQEN
GNAHTIA
Download sequence
Identical sequences F7AX73
ENSECAP00000019991 9796.ENSECAP00000019991 ENSECAP00000019991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]