SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020052 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020052
Domain Number 1 Region: 146-463
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.64e-80
Family Transglutaminase core 0.00000107
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 7.35e-41
Family Transglutaminase N-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 478-590
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.44e-26
Family Transglutaminase, two C-terminal domains 0.0022
Further Details:      
 
Domain Number 4 Region: 592-690
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.88e-26
Family Transglutaminase, two C-terminal domains 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020052   Gene: ENSECAG00000022419   Transcript: ENSECAT00000024153
Sequence length 696
Comment pep:known chromosome:EquCab2:1:145714496:145733123:1 gene:ENSECAG00000022419 transcript:ENSECAT00000024153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQALGIERCDFQTARNNEEHHTKAISSQHLIVRRGQPFTISLHFWTPIHKFPNNVALIA
QTGEQPSKAKGTQAILPISSPIPRPGDPKGWNAEVEEKEAQCWVISVTTPADAVIGNYSL
LLQVSGRKQHLLGKFTLLFNPWGREDAVFLENEAQRSEYLLNQNGLIYLGTADCIQEESW
DFGQFERDVFDLSLALLSEDKQVEQWGNPVHVACVLGSMLHAHKERSVLPIPQTQDAHEE
ALRNKRRGSVPILRQWLTGQGRPVYDGQAWVLAAVACTVLRCLGIPARVVTTFNSAQGTH
GSLLIDEYYNEEGFQNGEGQRGRIWIFQTSTECWMTRPALGQDYGGWQILYPRAPNKVGV
LGPCDLVPIRAVKEGTLELTPELTPAVSDLFATVNASCVVWKCRKDGTLELTASSTKYVG
NNISTKGVGVDRCEDITQNYKYPEGSPQEKEVLERVQKERMKHAKDNGMHPPSLESADPL
YLFLEAPSFLPVGGDAVFFVTLVNPSDQEKTVQLSVAVQAVYYNGILAAELWRKKQFLTL
TAKSVEKVSTSLSSSYFERRPPGNSFLRLTTRATHSESSLSCFAQEDILVRRPRLTIEMP
KTVKQHQPLTALVSIHNTLHAPMKDCVVSIYGRRLIHKERSYRLDAVWPGDTSYTQFRFT
PTQVGLQMLTVEMDCDVFQNLTNYRSVEVVAPELPA
Download sequence
Identical sequences F6ZDW1
ENSECAP00000020052 ENSECAP00000020052 9796.ENSECAP00000020052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]