SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020073 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020073
Domain Number 1 Region: 28-523
Classification Level Classification E-value
Superfamily Sema domain 4.05e-160
Family Sema domain 0.000000000237
Further Details:      
 
Domain Number 2 Region: 519-571
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000244
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 587-667
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000622
Family V set domains (antibody variable domain-like) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020073   Gene: ENSECAG00000022121   Transcript: ENSECAT00000024175
Sequence length 770
Comment pep:known chromosome:EquCab2:16:35275859:35285044:1 gene:ENSECAG00000022121 transcript:ENSECAT00000024175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPSAWAICCLLGGLLLRAGSPSPGPSVPRLRLSYRDLLSANRSAIFLGPRGSLDLRAMY
LDEYRDCLFLGGRDALYSLQLDQAWLDPREVLWPPQPGQREECVRKGRDPLMECANFVRV
LQPHNRTHLLVCGTGAFQPTCALITVGHRGEHVLHLEPGSVESGRGRCPHEPSRPFASTF
VGGDLYTGLTADFLGREAMIFRSGGPRPALRSDSDQNLLHDPRFVMAARIPDNSDRDDDK
VYFFFSETVPSPDGGPGRVTVSRVGRVCVNDAGGQRVLVNKWSTFLKARLVCSVPGLGGA
ETHFDQLEDVFLLWPKAGKSLEVYALFSTVSAVFQGFAVCVYHMVDIWEVFKGPFAHQDG
PQHQWGPYGGKVPFPRPGMCPSKMTAQPGRPFGSTKDYPDEVLHFARAHPLMFQPVRPRQ
GRPVLVKTHLAQQLRQIVVDRVEAEDGTYDVMFLGTDSGSVLKVIALQAGGSAEPEEVVL
EELQVFKVPTPITEMEISVKRQMLYVGSRLGVARLQLHQCETYGSACAECCLARDPYCAW
DGASCTHYRPGTSKRRFRRQDIRHGNPALQCLGQSREAEAAGLVATTTVYGTEHNSTFLE
CLPKSPQAAVRWFLQRPGDEGSDQVKTDERVLQTEQGLLFRRLSRLDAGTYTCTTLEHGF
SQMVVRLALEVIIATQLDSLFPRVPRPEDPPARGGLASTPTKAWYKDILQLIGFANLPRV
DEYCERVWCSSRSRGKQAKGKSWAGLELGKKVKSRVQAERNRTPREVEAT
Download sequence
Identical sequences F6ZCL2
9796.ENSECAP00000020073 XP_001915923.1.31192 ENSECAP00000020073 ENSECAP00000020073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]