SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020077 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020077
Domain Number 1 Region: 36-505
Classification Level Classification E-value
Superfamily Sema domain 7.06e-148
Family Sema domain 0.00000000675
Further Details:      
 
Domain Number 2 Region: 508-545
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000379
Family Plexin repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 573-662
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000225
Family I set domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020077   Gene: ENSECAG00000022499   Transcript: ENSECAT00000024179
Sequence length 844
Comment pep:known chromosome:EquCab2:1:28914582:28923800:-1 gene:ENSECAG00000022499 transcript:ENSECAT00000024179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGRLWPFLLSFLTATAFPGPSLRRPSRELDATPRMTIPYEELSGTRHFKGQAQNYSTLL
LDEASARLLVGARGALFSLNAHNIGDGSHKEIHWEASPEMQSKCHQKGKNNQTECFNHVR
FLQRLNATHLYACGTHAFQPLCAAIDAEAFTLPTSFEEGKEKCPYDPARGFTGLIIDGGL
YTATRYEFRSIPDIRRSRHPHSLRTEEAPMHWLNDAEFVFSVLVRESKASAVGDDDKVYY
FFTERAAEEGSGSFAQSRSSHRVARVARVCKGDLGGKKILQKKWTSFLKARLICHIPQYE
TLRGVCSLDTDTSSRAHFYAAFTLTTQWKTLEASAICRYDLAEVQAVFAGPYMEYQDGAR
RWGRYEGGVPEPRPGSCITDSLRSRGYNSSQDLPSLVLDFVKLHPLMARPVVPTRGRPLL
LKRSVRYTHLTGTPVTTPAGPTYDLLFLGTADGWIHKAVVLGSGMHIIEETQVFKEPQSV
ENLVISPMQHSLYVGAPGGVIQLPLSSCSRYHSCYDCILSRDPYCGWDPSTHACMATTTV
ANRSEGGRTALIQDIERGNRGCEGNRNTGPPPPLKTRSVLRGDDVLLPCDQPSNLARALW
LLNGSMGLSDGQDGYRIGVDGLLVTDTQPEHSGNYGCYAEENGLRTLLASYSLTVRPATP
APAPQAPALPGVQMAPDVRLLYVLAIAALGGLCLILASSLLYVACLQGGGRGRRRKYSLG
RVSRAGGSAVQLQTISGQCPGEEDEGDDGEGAGGLEGGCLQIIPGEGAPAPPPPPPPPPP
AELTNGLVALPSRLRRMNGNSYVLLRQSNNGVPAGPCSFAEELSRILEKRKHTQLVEHLD
ESSV
Download sequence
Identical sequences F7BSY9
9796.ENSECAP00000020077 ENSECAP00000020077 ENSECAP00000020077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]