SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020119 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020119
Domain Number 1 Region: 416-674
Classification Level Classification E-value
Superfamily YWTD domain 9.02e-49
Family YWTD domain 0.000000104
Further Details:      
 
Domain Number 2 Region: 207-246
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000223
Family LDL receptor-like module 0.0005
Further Details:      
 
Domain Number 3 Region: 5-41
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000327
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 4 Region: 122-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000327
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 5 Region: 245-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000419
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 6 Region: 43-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 7 Region: 160-198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 8 Region: 80-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.00017
Further Details:      
 
Domain Number 9 Region: 329-407,674-724
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000282
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 10 Region: 291-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000432
Family LDL receptor-like module 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020119   Gene: ENSECAG00000021859   Transcript: ENSECAT00000024225
Sequence length 846
Comment pep:known chromosome:EquCab2:23:24404554:24422150:1 gene:ENSECAG00000021859 transcript:ENSECAT00000024225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRKAKCEPSQFQCTNGRCITLLWKCDGDEDCADGSDEKNCVKKTCAESDFVCNNGQCVPN
RWQCDGDPDCEDGSDESPEQCHMRTCRINEISCGARSTQCIPVSWRCDGENDCDSGEDEE
NCGNITCSPDEFTCSSGRCISRNFVCNGQDDCNDGSDELDCAPPTCGAHEFQCSTSSCIP
NSWVCDDDADCSDQSDESLEQCGRQPVIHTKCPASEIQCGSGECIHKKWRCDGDPDCKDG
SDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKCR
SGECIDISKVCNQEQDCRDWSDEPLKECNVNECLVNNGGCSHICKDLVIGYECDCAAGFE
LIDRKTCGDIDECQNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSLIFTN
RRDIRKIGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASIDDKVGRHVK
MIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGTKRKFLFNSDLREPASIAVDPLS
GFVYWSDWGEPAKIEKAGMNGFDRRPLVTADIQWPNGITLDLIKSRLYWLDSKLHMLSSV
DLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSELATLVNNLND
AQDIIVYHELVQPAGKNWCEEDMENGGCEYLCLPAPQINDHSPKYTCSCPNGYKLEENGQ
QCQRTATTVTYSETKDTNTTEISPTSGLVPGGINVTTAVSEVSVPPKGTSAAWAILPLLL
LAMAAVGGYLMWRNWQHKNMKSMNFDNPVYLKTTEEDLSIDIGRHSASVGHTYPAISVVS
TDDDLA
Download sequence
Identical sequences F6U255
ENSECAP00000020119 9796.ENSECAP00000020119 ENSECAP00000020119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]