SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020168 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020168
Domain Number 1 Region: 397-529
Classification Level Classification E-value
Superfamily CalX-like 7.85e-34
Family CalX-beta domain 0.000004
Further Details:      
 
Domain Number 2 Region: 529-675
Classification Level Classification E-value
Superfamily CalX-like 3.66e-30
Family CalX-beta domain 0.00000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020168   Gene: ENSECAG00000022551   Transcript: ENSECAT00000024282
Sequence length 921
Comment pep:known chromosome:EquCab2:24:16063714:16182442:-1 gene:ENSECAG00000022551 transcript:ENSECAT00000024282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWLRLQPLTSAFLHFGLITFVLFLNGLRAEAGGSGDVPSTGQNNESCSGSSDCKEGVIL
PIWYPENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGE
TSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFI
IIGICVYVIPDGETRKIKHLRVFFVTAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFF
FPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDGN
LVPMEGKEVDESRREMIRILKDLKQKYPEKDLDQLVEMANYYALSHQQKSRAFYRIQATR
MMTGAGNILKKHAAEQAKKASSMSEVHTDEPEDFVSKVFFDPCSYQCLENCGAVLLTVVR
KGGDTSKTMYVDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHF
FVRLSNVRMEEEQPEEGMPPAVLNSLPLPRAVLVSPCVATVTILDDDHAGIFTFECDTIH
VSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDTYGDLEFKNDETVKTIRV
KIVDEEEYERQENFFIALGEPKWMERGISEMTDRKLTVEEEEAKRIAEMGKPILGEHPKL
EVIIEESYEFKSTVDKLIKKTNLALVVGTHSWKDQFMEAITVSAAGDEDEDESGEERLPS
CFDYVMHFLTVFWKVLFACVPPTEYCHGWACFVVSILIIGMLTAIIGDLASHFGCTIGLK
DSVTAVVFVAFGTSVPDTFASKAAAIQDVYADASIGNVTGSNAVNVFLGIGLAWSVAAIY
WALQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKLATTWLFV
SLWLLYILFATLEAYCYIKGF
Download sequence
Identical sequences F6VU44
ENSECAP00000020168 9796.ENSECAP00000020168 XP_008535465.1.77740 XP_014591158.1.31192 ENSECAP00000020168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]