SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020186 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020186
Domain Number 1 Region: 30-143
Classification Level Classification E-value
Superfamily E set domains 7.28e-33
Family SVA-like 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020186   Gene: ENSECAG00000022713   Transcript: ENSECAT00000024305
Sequence length 146
Comment pep:known chromosome:EquCab2:4:96211709:96217757:1 gene:ENSECAG00000022713 transcript:ENSECAT00000024305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSFQLLFRASPAALILVLCLQLGINKAQEYTRRAIIMDLQTPQTTTADEEVTVKLRVET
ELRECMVIKSYLLSDVPIDGAFNYKFTSCLCENYPRTFFWDFQTNSTVRIAAVVDVIREQ
NICPEDLAVIPMTANRFHILRTLNKV
Download sequence
Identical sequences F6V6R7
ENSECAP00000020186 XP_008507653.1.77740 XP_014594740.1.31192 9796.ENSECAP00000020186 ENSECAP00000020186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]