SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020201 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020201
Domain Number 1 Region: 139-381
Classification Level Classification E-value
Superfamily vWA-like 2e-84
Family Integrin A (or I) domain 0.000000204
Further Details:      
 
Domain Number 2 Region: 639-727
Classification Level Classification E-value
Superfamily Integrin beta tail domain 6.67e-23
Family Integrin beta tail domain 0.00088
Further Details:      
 
Domain Number 3 Region: 358-469
Classification Level Classification E-value
Superfamily Integrin domains 1.78e-20
Family Integrin domains 0.0012
Further Details:      
 
Domain Number 4 Region: 25-84
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000256
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 596-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000226
Family Integrin beta EGF-like domains 0.0034
Further Details:      
 
Domain Number 6 Region: 555-593
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Integrin beta EGF-like domains 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000020201
Domain Number - Region: 521-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0268
Family Integrin beta EGF-like domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020201   Gene: ENSECAG00000022498   Transcript: ENSECAT00000024324
Sequence length 799
Comment pep:known chromosome:EquCab2:29:5050333:5076897:1 gene:ENSECAG00000022498 transcript:ENSECAT00000024324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMNLQLVFWIGLISSICYVFGQADENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMP
TSARCDDLEALKKKGCHPDDIENPRGSKDIKKNKNVTNRSKGTAEKLQPEDITQIQPQQL
VLQLRSGEPQTFALKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSD
FRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDKGEVFNELVGKQ
RISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDG
QCHLENDVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGT
LSANSSNVIQLIIDAYNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGRKCSNIS
IGDEVQFEISITSNKCPNKNSETIKIKPLGFTEEVEVVLQFICECECQSEGVPSSPRCHE
GNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCR
KRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTTSC
MATNGQICNGRGICECGACKCTDPKFQGPTCEMCQTCLGVCAEHKECVQCRAFNKGEKKD
TCAQECSHFNITKVENRDKLPQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEAIVHVVE
TPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGE
NPIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences F6UR46
ENSECAP00000020201 9796.ENSECAP00000020201 ENSECAP00000020201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]