SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020248 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000020248
Domain Number - Region: 259-351
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0652
Family APC10-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020248   Gene: ENSECAG00000022760   Transcript: ENSECAT00000024379
Sequence length 356
Comment pep:known chromosome:EquCab2:4:18093239:18125461:-1 gene:ENSECAG00000022760 transcript:ENSECAT00000024379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRPKSRKGARVIRVHSEEASSTSSSDTVLSEHGNPDSNRLTGSWKIIISMAFILTFLL
IGLRNHMWLKETEFPQKSRPFYSVIAEYGSRLYNYQARRRMPKEQVELVKKESRTLENNF
REILFLIEQIDVLKALLRDMQNGLHSYSWNPDGDPTEVQNHTEEISNLVNYVLKKLREDQ
VQMADYALKSAGASIIEAGTSESYKNSKAKLYWHGIGFLNYEMPPDIILQPDVHPGKCWA
FPGSQGHALIKLAMKIIPTAVTMEHISEKVSPSGDISSAPKEFSVYGMSKQCEGEEIFLG
QFVYNRTGATIQTFELQHKVPESLLCVKLKILSNWGHLKYTCLYRFRVHGTPGDDT
Download sequence
Identical sequences F6UPU6
ENSECAP00000020248 ENSECAP00000020248 9796.ENSECAP00000020248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]