SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020293 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020293
Domain Number 1 Region: 597-883
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-82
Family Protein kinases, catalytic subunit 0.00000000329
Further Details:      
 
Domain Number 2 Region: 2-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.15e-69
Family Ephrin receptor ligand binding domain 0.00000185
Further Details:      
 
Domain Number 3 Region: 297-504
Classification Level Classification E-value
Superfamily Fibronectin type III 7.55e-41
Family Fibronectin type III 0.00000376
Further Details:      
 
Domain Number 4 Region: 900-967
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.09e-19
Family SAM (sterile alpha motif) domain 0.0000331
Further Details:      
 
Domain Number 5 Region: 228-294,329-357
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000589
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020293   Gene: ENSECAG00000022132   Transcript: ENSECAT00000024428
Sequence length 971
Comment pep:known chromosome:EquCab2:2:32102542:32131165:-1 gene:ENSECAG00000022132 transcript:ENSECAT00000024428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNLLDTSTIHGDWGWLTYPAHGWDSINEVDESFRPIHTYQVCNVMSPNQNNWLRTSWVPR
DGARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRDLGSSTQESQFLKIDTIAAD
ESFTGADLGVRRLKLNTEVRGVGPLSKRGFYLAFQDIGACLAILSLRIYYKKCPTMVRNL
AAFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAEGEWLVPIGKCVCSAGYEERRD
ACVACELGFYKSAPGDQLCARCPPHSHSAAPAAQACRCDLSYYRAALDPPSAACTRPPSA
PVNLISSVNGTSVTLEWAPPLDPGGRSDITYNAVCRRCPWTLDHCETCGSGTRFVPQQTS
LVQASLLVANLLAHMNYSFWIEAVNGVSDLSPEPRRAAVVNITTNQAAPSQVVVIRQERA
GQTSVSLLWQEPEQPNGIILEYEIKYYEKDKEMQSYSTLKAVTTRATVSGLKPGTRYVFQ
VRARTSAGCGRFSQAMEVETGKPRPRYDTRTIVWICLTLITGLVVLLLLLICKKRHCGYS
KAFQDSDEEKMRYQNGQAPPPVFLPLHHPPGKIPEPQLCAEPHTYEEPGRAGRSFTREIE
ASRIHIEKIIGSGESGEVCYGWLRVPGQQDVPVAIKALKAGYTERQRRDFLSEASIMGQF
DHPNIIRLEGVVTRGRLAMIVTEYMENGSLDAFLRTHDGQFTVMQLVGMLRGVAAGMRYL
SDLGYVHRDLAARNVLVDGNLVCKVSDFGLSRVLEDDPDAAYTTTGGKIPIRWTAPEAIA
FRTFSSASDVWSFGVVMWEVLAYGERPYWNMTNRDVISSVEEGYRLPAPMGCPRALHQLM
LDCWHKDRAQRPRFSQILSVLDALIRSPETLRATATVSRCPPPAFARSCFDLRGGSGGLT
VGDWLDSIRMGRYRDHFAAGGYSSLGMVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQ
LTSTQGPRRHL
Download sequence
Identical sequences F6TVD7
ENSECAP00000020293 9796.ENSECAP00000020293 ENSECAP00000020293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]