SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020306 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020306
Domain Number 1 Region: 9-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-47
Family Galectin (animal S-lectin) 0.00012
Further Details:      
 
Domain Number 2 Region: 228-357
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.36e-42
Family Galectin (animal S-lectin) 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020306   Gene: ENSECAG00000022377   Transcript: ENSECAT00000024447
Sequence length 358
Comment pep:known chromosome:EquCab2:11:41626509:41638090:-1 gene:ENSECAG00000022377 transcript:ENSECAT00000024447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFTCAQPPYLNPVTPFSGIIQGGLQEGLEITVRGTVLPSSGTRFAVDFQTGRSDDDIAF
HFNPRFEEGGSVVCNTKEKGRWGPEEKKTHLPFQRGSPFELSFLVLSSCFQVMLNGSLFV
RYPHRVPFHRMDTLSVTGAVQLSSISFQSPDSYPVPPAFSTRQFSQAAHFPHKPNGHKPQ
VRVSVHPALLWPTAQTMIHRELSAPQQMSENPTFPPMGYPNPAYITMNPFYTCIPGGLYP
SRRIIVSGTILPNAQWFHINLRSGSDIAFHLNPRFNQNSVVRNSLINGSWGHEEKYLCGP
MPFIRGQSFTVRITCKAHRLRVAVNGVRKFDYNHRMKNFCAINVLDVAGHIRLTHVQL
Download sequence
Identical sequences F6WEK3
ENSECAP00000020306 ENSECAP00000020306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]