SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020319 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020319
Domain Number 1 Region: 118-470
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.1e-92
Family beta-glycanases 0.00000000000388
Further Details:      
 
Domain Number 2 Region: 40-135
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 4.68e-47
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.0000228
Further Details:      
 
Domain Number 3 Region: 469-536
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.04e-28
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.0000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020319   Gene: ENSECAG00000022786   Transcript: ENSECAT00000024461
Sequence length 536
Comment pep:known chromosome:EquCab2:5:42684914:42689860:1 gene:ENSECAG00000022786 transcript:ENSECAT00000024461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSSPSREGCLKCPGRVGIMAASFMGLLLLQAVSRASGARPCSPKSFGYSSVVCVCNAT
YCDSLDPLTLPAPGTFSRYESTRSGRRMELSLGAIQANRTGTGLLLTLQPDQKFQKVKGF
GGAMTDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDFSIRVYTYADTPDD
FQLHNFSLPEEDVKLKIPLIHQALELSQRPISLFASPWTSPTWLKTNGAVNGKGSLKGQP
GDRYHQTWAKYFVKFLDAYAEHKLQFWAVTTENEPSAGLISGYPFQCLGFTPEHQRDFIA
RDLGPTLANSTHRNVRVLMLDDQRLLLPRWAQVVLADPEAAKYVHGIAVHWYLDFLAPAK
ATLGETHRLFPDMMLFASEACVGSKFWEQSVRLGSWDRGVQYSHSIITNLLYHVAGWTDW
NLALNPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVGLDASEK
TNLDTVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETVSPGYSIHTYLWRRQ
Download sequence
Identical sequences F6WDY8
ENSECAP00000020319 9796.ENSECAP00000020319 XP_001498700.3.31192 XP_005610105.1.31192 XP_008521305.1.77740 XP_008521306.1.77740 XP_008521307.1.77740 XP_008521308.1.77740 XP_014595388.1.31192 ENSECAP00000020319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]