SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020379 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020379
Domain Number 1 Region: 306-449
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-39
Family Third domain of FERM 0.00000398
Further Details:      
 
Domain Number 2 Region: 202-307
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-36
Family Second domain of FERM 0.000000883
Further Details:      
 
Domain Number 3 Region: 121-201
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.69e-25
Family First domain of FERM 0.00000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020379   Gene: ENSECAG00000022255   Transcript: ENSECAT00000024526
Sequence length 738
Comment pep:known chromosome:EquCab2:2:27099897:27271085:-1 gene:ENSECAG00000022255 transcript:ENSECAT00000024526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKSQVSEEEGKEVESGTEKGEGGQREREFGTSLDEEIILKAPIAAPEPELKTDPSLDLHS
LSSAETQPAQEERREDPDFETKEEEGLEECSKIEVKEESPESKAERELKASQKSIRRHRN
MHCKVSLLDDTVYECVVEKHAKGQDLHKRVCEHLNLLEEDYFGLAIWDNTTSKTWLDPAK
EIKKQVRGVPWNFTFNVKFYPPDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLG
SYTVQSELGDYDPELHGADYVSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLEN
AKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRINRFPWPKVLKISYKRSSFFI
KIRPGEQEQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLTSTDTIPKSKFLALGSKFRY
SGRTQAQTRQASALIDRPAPHFERTASKRASRSLDGAAAVDSADRSPRPTSAPAIAQSQV
TEGAPVKKAGVSKAQKETAEAEVKGEEVPPEQAEPEPTEVQKKKRERLDGENIYIRHSNL
MLEDLGKSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFRTPNINGQIPTG
EGPPLVKTQTVTISDTANAVKSEIPTKDVPIVHTETKTITYEAAQTDDSNGDLDPGVLLS
AQTITSETTSSTTTTQITKTVKGGISETRIEKRIVITGDADIDHDQVLVQAIKEAKEQHP
DMSVTKVVVHQETEISEE
Download sequence
Identical sequences F6VTG8
9796.ENSECAP00000020379 ENSECAP00000020379 ENSECAP00000020379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]