SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020397 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020397
Domain Number 1 Region: 357-615
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.44e-59
Family Creatinase/aminopeptidase 0.0001
Further Details:      
 
Domain Number 2 Region: 82-173
Classification Level Classification E-value
Superfamily Creatinase/prolidase N-terminal domain 0.0000000112
Family Creatinase/prolidase N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020397   Gene: ENSECAG00000022579   Transcript: ENSECAT00000024546
Sequence length 657
Comment pep:known chromosome:EquCab2:1:21404957:21452671:1 gene:ENSECAG00000022579 transcript:ENSECAT00000024546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRANHQDFLLKNLRIIEPNEVTHTGDPGVETDSRMAPKVTSELLRQLRQAMRNLEYVTEP
IQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQM
DSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPV
KENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVVWFVVTALDEIA
WLFNLRGSDVEHNPVFFSYAVIGLETIMLFIDGDRIDTPSVKEHLLLDLGLEAEYRIQVL
PYKSILSKLKALCADLSPREKVWVSDKASYAVSEAIPKDHRCCMPYTPICIAKAVKNSAE
SEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISS
TGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPKAYEKECFTY
VLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISY
KTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVP
IQTKMIDVDSLTDKECDWLNNYHLTCRDVVGKELQKQGRQEALEWLIRETQPISRQH
Download sequence
Identical sequences F6VSD4
ENSECAP00000020397 ENSECAP00000020397 9796.ENSECAP00000020397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]