SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020429 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020429
Domain Number 1 Region: 572-772
Classification Level Classification E-value
Superfamily vWA-like 7.51e-36
Family Integrin A (or I) domain 0.0033
Further Details:      
 
Domain Number 2 Region: 32-248
Classification Level Classification E-value
Superfamily vWA-like 1.19e-33
Family Integrin A (or I) domain 0.013
Further Details:      
 
Domain Number 3 Region: 817-1011
Classification Level Classification E-value
Superfamily vWA-like 1.17e-29
Family Integrin A (or I) domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020429   Gene: ENSECAG00000022731   Transcript: ENSECAT00000024583
Sequence length 1027
Comment pep:known chromosome:EquCab2:26:41057463:41199477:1 gene:ENSECAG00000022731 transcript:ENSECAT00000024583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLASALLLLLLQACWAAAQDDTAAVRTVAFQDCPVDLFFVLDTSESVALRLKPYGALVD
KVKAFTKRFIDNLRDRYYRCDRNLVWNAGALHYSDEVEIIRGLTRMPSGRDELKASVDAV
KYFGKGTYTDCAIKKGLEELLVGGSHLKENKYLIVVTDGHPLEGYKEPCGGLEDAVNEAK
HLGIKVFSVAITPDHLEPRLSIIATDHTYRRNFTAADWGQSRDAEEIISQTIDTITDMIK
NNVEQVCCSFECQPARGPPGLRGDPGYEGERGKPGLPGEKGEAGDPGRPGDLGPVGYQGM
KGEKGSRGDKGSRGPKGYKGEKGKRGIDGVDGMKGETGYPGLPGCKGSPGLDGVQGPPGP
KGDAGAFGLKGAKGEPGADGEPGRPGDTGPPGDEGEPGEPGPPGEKGEAGDEGNSGPDGP
PGDRGGPGERGPRGTPGVRGPRGDPGEAGPQGDQGREGPVGVPGDPGEAGPIGPKGYRGD
EGPPGLEGPRGAPGPAGPPGDPGLMGARGEDGPPGNGTEGFPGFPGYPGSRGPPGINGTK
GYPGLKGDEGEAGDPGEDNTDISPRGVKGAKGYRGPEGPPGPPGPPGRPEMDECEILDII
MKMCSCCECKCGPIDILFVLDSSESIGLQNFEIAKDFIVKVIDRLSRDELVKFEAGQSHA
GVVQYSHNQMQEHVGLSDPNIRNTQELKEAIKKLQWMAGGTFTGEALQYTRSRLLPPTQN
TRIALVITDGRSDTQRDTTPLSVLCGPDIQVVSVGIKDVFGSIAGSDQLNVISCQGLAPQ
GRPGISLVKENYAELLEDAFLKNITTQICIDKKCPDYTCPITFSSPADITILLDGSASVG
SHNFDITKRFAKRLAERFLTARRKNPAHEVRVSVMQYSGTGQQQPERASLQFLQNYTVLA
STIDSMDFINDATDVTDALSYVTRFYREASSEEVDRRLLLFSDGNSQGATAAAIKKAVQE
AQRANIEVFVVVVGTHVNEPHIRVLVTDKTAEYNVAYGQRHQFRVASYQELLGGVFYQSV
SRKVAMG
Download sequence
Identical sequences F6UW03
9796.ENSECAP00000020429 XP_001488401.2.31192 XP_008529617.1.77740 ENSECAP00000020429 ENSECAP00000020429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]