SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020462 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020462
Domain Number 1 Region: 191-303
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-18
Family Spermadhesin, CUB domain 0.005
Further Details:      
 
Domain Number 2 Region: 398-435
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 3 Region: 137-174
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000107
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 4 Region: 32-140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000288
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 5 Region: 328-353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000641
Family LDL receptor-like module 0.003
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000020462
Domain Number - Region: 355-397
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00111
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020462   Gene: ENSECAG00000022955   Transcript: ENSECAT00000024622
Sequence length 713
Comment pep:known chromosome:EquCab2:1:161092726:161097204:1 gene:ENSECAG00000022955 transcript:ENSECAT00000024622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTLLPFLALPLGGAVAHPDRIIFPHPACVDPPAVLLEVQGTLQRPLGRDSRTFPANCTWL
ILGSKEQTVTVRFQKLHLACGSERLILSSPLQPQISLCEAPASPLQLPGGNVTITYSYAG
ARAPMGQGFLLSYSQDWLMCLPEEFQCLNHRCVPTTQRCNGVDACGDGSDEAGCGSDPFP
DLTPAPIPNLPCNHTLEEFYGIFSSPGYSHLASVSHPQSCTWLLDPHDGRRLAVRFTALD
LGYGDAVHVYDGAGPPETSQLLRSLTHFSNGKAVTVETLSGQATVAYHTVAWSSGRGFNA
TYHVRGYCLPWDRPCGLGSGLGASEGLGDRCYSEAQRCDGSWDCADGTDEKNCPSCPPGH
FPCGAAGTPGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDG
QPDCADGSDEWDCSYALPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSVFAPL
SRMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTPGG
ASGARRRQRGRSVRRLVRRLRRWGLLPRTNPPARNPENRSQVTPSAAPLEALDGSTSPAR
EGGAVGGQDGEQAPPLPIKALLPSASTSPALPTVPEAPGPLPSASLEPSLLSGVMQALRG
RLLPSLQPPGPTRTPPEPHTTVLSPEDEDDVLLVPLAEPGVWVVEAEDEPLLA
Download sequence
Identical sequences F6UGF3
XP_001918353.2.31192 ENSECAP00000020462 ENSECAP00000020462 9796.ENSECAP00000020462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]