SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020493 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020493
Domain Number 1 Region: 522-848
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.14e-74
Family Hect, E3 ligase catalytic domain 0.00016
Further Details:      
 
Domain Number 2 Region: 171-369
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.87e-41
Family APC10-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020493   Gene: ENSECAG00000022793   Transcript: ENSECAT00000024659
Sequence length 860
Comment pep:known chromosome:EquCab2:2:13426346:13434048:1 gene:ENSECAG00000022793 transcript:ENSECAT00000024659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAMASPGVALESPRQLLGRVRFLAEQRETLRAVRPRPRRWLSCRAEVLYKLYKNPAPSRV
LLPVWEAEGLGLRVGAAGAAAGTGSGPLRAARDSIELRRGACVRTTGEELCNGHGLWVKL
TKEQLAEHLGDCGLDEGWLLVCRPAEGGARLVPIDTPDHLQRQQQLFGVDYRPVLRWEQV
VDLTYSHRLGSRPQPAEAYTEAVQRLLYVPPTWTYECDEDLIHFLYDHLGKEDENLGSVK
QYVESIDVSSYTEEFNVSCLTDSNADTYWESDGSQCQHWVRLTMKKGTIVKKLLLTVDTT
DDNFMPKRVVVYGGEGDNLKKLSDVSIDESLIGDVCVLEDMTVHLPIIEIRIVECRDDGI
DVRLRGVKIKSSRQRELGLNADLFQPTSLVRYPRLEGTDPEVLYRRAVLLQRFIKILDSV
LHRLVPAWDHTLGTFSEIKQVKQLLLLSRQRPGLVAQCLRDSESSKPSFMPRLYINRRLA
MEHRACPLRDPACKNAVFTQVYEGLKPSDKYEKPLDYRWPMRYDQWWECKFIAEGIIDQG
GGFRDSLADMSEELCPSSADTPLPLPFFVRTANQGNGTGEARDMYVPNPSCRDFAKYEWI
GQLMGAALRGKEFLVLALPGFVWKQLSGEEVSWSKDFPAVDSVLVKLLEVMEGMDKETFE
FKFGKELTFTTVLSDQQVVELIPGGAGIVVGYEDRSRFIQLVQKARLEESKEQVAAMQAG
LLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFEDFEPSDTRVQYFWEALNNFT
NEDRSRFLRFVTGRSRLPARIFVYPDKLGYETTDALPESSTCSSTLFLPHYASAKVCEEK
LRYAAYNCVAIDTDMSPWEE
Download sequence
Identical sequences F6U8N0
9796.ENSECAP00000020493 ENSECAP00000020493 ENSECAP00000020493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]