SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020497 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020497
Domain Number 1 Region: 4-223
Classification Level Classification E-value
Superfamily Sema domain 8.11e-32
Family Sema domain 0.0072
Further Details:      
 
Domain Number 2 Region: 824-953,1127-1275
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.24e-28
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 225-273
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000798
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 440-526
Classification Level Classification E-value
Superfamily E set domains 0.0000967
Family E-set domains of sugar-utilizing enzymes 0.059
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000020497
Domain Number - Region: 530-605
Classification Level Classification E-value
Superfamily E set domains 0.0245
Family E-set domains of sugar-utilizing enzymes 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020497   Gene: ENSECAG00000022971   Transcript: ENSECAT00000024664
Sequence length 1343
Comment pep:known chromosome:EquCab2:28:19465243:19604379:1 gene:ENSECAG00000022971 transcript:ENSECAT00000024664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGSPAFVDRLSLNGSVYFPTPYNYTSGAATGWPSMARIAQSADVQFQGQAALDCGHGHPD
GRRLLLSSSLVEALDVWAGVFSAATGESQERRSPATTALCLFRMSEIQARAAESCSGDFE
SDQNCKEGEQPERVQPIASSTLIHSDLTSVYGTVVMNRTVLFLGTGDGQLLKVILGENLT
SNCPEVIYEIKEETPVFYKLIPHPKKNIYIYLTAGKEVRRIPVANCSKHKSCSACLTVSD
PHCGWCHSLQRCTFKEDCVDLQNSENWLDISSGAKECPQIHMFRGSKNKTTVTVVGSFSP
RHSECVVKHVDSTRELCKGKSRGNETCTCNIPTRSPDKDALVVSVTFSFDAWHLSKRFNF
TNCSSLRECAVCIGTGCAWCKSERRCIHPFRACDPSDYNRDQTLCQVAVGKWIPPETAGG
GRLKENKRDRTKKGLQVFYVRSIEPQKISTLGKSNVTVTGANFTQASNITMILKGTSTCD
KDVIQVSHVLNDTHMKFSLPSSRKEMKDVCIQFDGGNCSSVGPLSYIALPHCSLIFPATT
WISGGQNITIMGRNFDVIDKLIISHEVRGNINVPEYCMATYCTFLAPNLKNSKVHPNVTV
KLRVQDTYLDCGSLRYLEDPRFAGYRVEPEGDTELEVRIQKENDNFNISKKDIEITLFRG
KNPPLNCSFENITRNQDLTTILCKIKGITAASSIASSSEKVRVKLGNLELFVERESVPSP
WYFLIVLPVLLVIVIFAVGVTRHKSKELSRKQSQQLELLESELRKEIRDGFAELQMDKLD
VVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKNESLTALDALICNKSF
LVTVIHTLEKQKNFSVKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQSSNMQPKLM
LRRTESVVEKLLTNWMSVCLSGFLRETVGEPFYLLVTTLNQKINKGPVDVITCKALYTLN
EDWLLWQVPEFSTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKN
GSPYGLQLNEIGLELQLGTRQKELLDIDGSSVILEDGITKLNTIGHYEISNGSTIKVFKR
IANFTSEVEYSEDHCHLILPDSEAFQDVQGKRHRGKHKFKVKEMYLTKLLSTKVAIHSVL
EKLFRSIWSLPNSRAPFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVNILKN
PQFVFDIKKTPHIDGCLSVIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKDEVKSY
YRAIRELPPLSSSEMEEFLTQESKKHENEFNEEVALTEIYKYIVKYFDEILNKLERERGL
EEAQKQLLHVKVLFDEKKKCKWM
Download sequence
Identical sequences F6U8I4
9796.ENSECAP00000020497 ENSECAP00000020497 ENSECAP00000020497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]