SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020529 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020529
Domain Number 1 Region: 1-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.23e-68
Family Ephrin receptor ligand binding domain 0.0000024
Further Details:      
 
Domain Number 2 Region: 608-901
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.23e-62
Family Protein kinases, catalytic subunit 0.0000000766
Further Details:      
 
Domain Number 3 Region: 901-969
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000174
Family SAM (sterile alpha motif) domain 0.00087
Further Details:      
 
Domain Number 4 Region: 426-503
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000317
Family Fibronectin type III 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020529   Gene: ENSECAG00000022781   Transcript: ENSECAT00000024699
Sequence length 976
Comment pep:known chromosome:EquCab2:2:19903764:19936320:1 gene:ENSECAG00000022781 transcript:ENSECAT00000024699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VILLDSKASQAELGWTALPSNGWEEISGVDEHDRPIRTYQVCNVLEPNQDNWLQTGWISR
GRGQRIFVELQFTLRDCSSIPGAAGTCKETFNVYYLETEADLGLGRLRLGGSRRRKIDTI
AADESFTQGDLGERKMKLNTEVREIGPLSRRGFHLAFQDVGACVALVSVRVYYKQCRATV
RGLAVFPATAAESAFSTLVEVTGTCVAHSEGEPGSPPRMHCGADGEWLVPVGRCSCSAGF
QERGDICEDKAGRWYKSPGERAQVARVPVSSQVSREGGEEAGCRGKEEDWPQRGALIPSS
RPEEKEERAEFTLSKASVTQQRQPPKKAGSPSPTLTITCVCQCLCNWELSQLVRGGLSLG
YIPRSGSAVSYTVVACLLAHSHPSVQQERGHVLSDGSRGESFLAPSSLWKGDMAVEQVSN
SIRRDRVEPQSVSLSWREPIPAGSPGANGTEYEIRYYEKGQSEQTYSTVKTGAPAVTVTN
LKPATRYVFQIRAASPGPSWETQSFNPSIEVQTPEEGNNLTLEVTSRSRNQSPAVVVTVV
TISALLVLGSVMSVLAIWRRPCSYGKGGRDAHDEEELYFHFKVPTRRTFVDPQSCGDPLQ
AVHLFAKELDAKSMSPSSFLGHRRFGELCCGCLQLPGRQELPVAVHTLREGCSDSQRLSF
LAEALTLGQFDHSHVVRLEGVVTRGKARTLMIVTEYMSHGALDGFLRRHEGQLAAGQLMG
LLPGLASAMKYLSEMGYVHRGLAARRVLVSSSLLCKISGFGRGPRDRAEAVYTTMSGRSP
ALWAAPETLQFGHFSSASDVWSFGVVMWEVMAFGERPYWDMSGQDVMKAVEDGFRLPPPR
NCPTPLHRLMLDCWQRDPGERPRFSQIHSILSKMGQDPEPPKSPLLHRPPTPLADRAFST
FPSFGSVGAWLEALDLGRYKDSFAAAGYGSLEAVPMTAQDLAGLGISSVEHREALLSGIG
ALQARVLQLRGRGVQV
Download sequence
Identical sequences F6TDC6
9796.ENSECAP00000020529 ENSECAP00000020529 ENSECAP00000020529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]