SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020647 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020647
Domain Number 1 Region: 38-243
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-39
Family Laminin G-like module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000020647
Domain Number - Region: 1594-1645
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00371
Family Fibrinogen C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020647   Gene: ENSECAG00000021205   Transcript: ENSECAT00000024831
Sequence length 1805
Comment pep:known chromosome:EquCab2:5:63514498:63709742:1 gene:ENSECAG00000021205 transcript:ENSECAT00000024831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERWSSRWKTKRWLWDFTITTLALTFLFQAREVRGAAPVDVLKALDFHNSPEGITKTTGF
CTNRKNSQGSDTAYRVSKQAQLSAPTKQLFSGGTFPEDFSILFTVKPKKGVQSFLLSIYN
EHGIQQVGVEVGRSPVFLFEDHTGKPAPEDYPLFRTVNIADGKWHRVAISVEKKTVTMIV
DCKKKTTKPLERSERSIVDTNGITVFGTRILDEEVFEGDIQQLLIIGDPKAAYDYCEHYS
PDCDSSAPKAAQAQEPQIDEYAPEDIIEYDYEYGEAEYKEAESVTEIPTVTEETIAQTEA
NIVDDFQEYNYGTVESYQTEAPRRVSGPNEPNPVEEVFTEEYLTGEDYDSQRKNAEDTLY
ENKGIDGRDSDLPVDGDLGEYDFYEYKEYEDKPTGPTNEEFGPGVPAETDITETSINGHG
AYGEKGQKGEPAVVEPGMLIEGPPGPAGPAGLMGPPGLQGPTGPPGDPGERGPPGRPGLP
GADGLPGPPGTMLMLPFRYGGDGSKGPTISAQEAQAQAILQQARIALRGPPGPMGLTGRP
GPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDR
GFDGLPGLPGDKGHRGERGPQGPPGPPGEDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTP
GPTGQPGIAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQGLPGPQGPIGPPGEKGPQGKP
GLGGLPGADGPPGHPGKEGQSGEKGALGPPGPQGPIGYPGPRGVKGADGVRGLKGSKGEK
GEDGFPGFKGDMGLKGDRGEVGQVGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVP
GLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGSRGARGPTGKP
GPKGTSGGDGPPGPPGERGPQGPQGPVGFPGPKGPPGPPGKDGLPGHPGQRGETGFQGKT
GPPGPGGVVGPQGPTGETGPIGERGHPGPPGPPGEQGLPGAAGKEGAKGDPGPQGISGKD
GPAGLRGFPGERGLPGAQGAPGLKGGEGPQGPPGPVGSPGERGSAGTAGPIGLPGRPGPQ
GPPGPAGEKGAPGEKGPQGPGRDGVQGPVGLPGPAGPAGSPGEDGDKGEIGEPGQKGSKG
DKGENGPPGPPGLQGPVGAPGIAGGDGEPGPRGQQGMFGQKGDEGARGFPGPPGPIGLQG
LPGPPGEKGENGDVGPMGPPGPPGPRGPQGPNGADGPQGPPGSIGSVGGVGEKGEPGEAG
NPGPPGEAGTGGPKGERGEKGEAGPPGAAGPPGAKGPPGDDGPKGNPGPVGFPGDPGPPG
EPGPAGQDGVGGDKGEDGDPGQPGPPGPSGEAGPPGPPGKRGPPGAAGAEGRQGEKGAKG
EAGAEGPAGKTGPVGPQGPAGKPGPEGLRGIPGPVGEQGLPGAAGQDGPPGPMGPPGLPG
LKGDPGSKGEKGHPGLIGLIGPPGEQGEKGDRGLPGTQGSPGAKGDGGIPGPAGPIGPPG
PPGLPGPQGPKGTKGSTGPAGQKGDSGLPGPPGPPGPPGEVIQPLPILSPKKTRRHTESM
QADAGDNILDYSDGMEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCKDLQLSHPDFPDGE
YWIDPNQGCSGDSFKVYCNFTSGGETCIYPDRKSEGVRISSWPKEKPGSWFSEFKRGKLL
SYLDVEGNSINMVQMTFLKLLTASARQNFTYNCHQSVAWYDVSSGSYDKALRFLGSNDEE
MSYDNNPYIKALYDGCASRKGYEKTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVGP
VCFLG
Download sequence
Identical sequences F6VBF7
9796.ENSECAP00000020647 ENSECAP00000020647 ENSECAP00000020647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]