SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020689 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020689
Domain Number 1 Region: 882-1173
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.1e-86
Family Complement components 0.0000171
Further Details:      
 
Domain Number 2 Region: 1254-1382
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.09e-30
Family Alpha-macroglobulin receptor domain 0.0016
Further Details:      
 
Domain Number 3 Region: 717-769
Classification Level Classification E-value
Superfamily E set domains 0.000000000994
Family SVA-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020689   Gene: ENSECAG00000023066   Transcript: ENSECAT00000024883
Sequence length 1420
Comment pep:known chromosome:EquCab2:10:28582767:28722876:1 gene:ENSECAG00000023066 transcript:ENSECAT00000024883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRFLVTAPGIIRPGGNVTIGVELLEHSPPQVTVKAELVKKAANLTVSVLEAEGLFEKGSF
KTLILPSLPLNSADEIYELHVAGRAQDEILFSNSTRLSFETKRMTVFIQTDKSLYKPKQD
VKFRIVTLFSDFKPCRTAVNILIKDPKSNLIQQWLSEQSDLGVISKTFRLSSHPILGDWS
IQVQVNDQMYYQSFQVSEYVLPKFEVALQTPLYCSLNSKSLNGTVIAKYTYGKPVKGDVT
LTFLPLSFWGMKKNITKKFKINGYANFSFNDEEMKKVMEFSDGLSEHVYLSSPGPVEILA
TVTESLTGISRNASSNVFFKQHDHIIEFFDYATVLKPSLNFTATVKVTRSDGNQLTPEER
RTNVVITVTQRNYTVYWSRWNSRDQEVEAVQIINYTVPQNGIFKIEFPILDDSSELQLKA
SFLNSVSSMAVHGMFMSPSKTYIQLKTRDENIKVGSPFELVVSGNKQLKELSYMVVSRGQ
LVAVGKQNSTAFSLTPENSWAPKACIIVYYIEDDGEIINDVLKIPVHLVFKNKINLFWSK
ANAEPSEKVSLRVSVTQPDSVVGIVAVDKSVNLMNASNDITMENVVHELELYNTGYYLGM
FMNSFAVFQECGLWVLTDAHLVKDSIDGVYDSVESAERFVEESEAYMVDLRDFALGGRPH
VRRHFPETWLWLDANMGSRMDEEFEVTVPDSITSWVATAFVISEDLGLGLTTTPVELQAF
QPFFIFLNLPYSVIRGEEFALEVTIFNYLKDVTEVKVIIEKSDKFDILMASNEINATGHQ
QTILVPSEDGATVLFPIKPIRLGEIPITVTAVSLAASDAVTQKILVKAEGIEKSYSQSIL
LDLTDNKLQTTLKTLSFSFPPDTVSGSARVQVTAIGDILGSSINGLASLIRMPYGCGEQN
MINFAPNIYVLDYLTKKKQLTENLKEKALSFMRQGYQRELLYQREDGSFSAFGKDDPSGS
TWLSAFVLRCFLEADPYIDIDQNVLHRTYTWLKGRQKSSGEFWEPGRVIHSELQGGSTSP
VTLTAYIVTSLLGYKKYQPNIDVQESINFLESEFNRGISDNYTLALITHALSSVRSPKAK
EALDMLTWRAEREGDTQFWVSSVSRLSESWQPSSLDIEVAAYALLSHFLQGQLSAGVPVM
RWLSRQRNRLGGFVSTQDTIVALKALSEFAALMNTERTNIQVTVMGPTSPSPVKFLIDTQ
NRFLLQTAELAAVQPTTVNISAKGLGFAVCQLNIIYNVKDSGSSRSQKSIQNQEAFDLDV
AVKDNKDDLNHLNLNVCTRFLGPARSGMALMEVNLLSGFMVPSDAIPLSETLKKVEHEHG
KLNLYLDSVNETLFCVDIPAVRNFKVSNTQDALVSIVDYYEPRRQAVRSYNSEVKLSSCD
LCGDDHSCRPCENGVAASCCHSSVVFVFCFVLLFSLQCWL
Download sequence
Identical sequences F6V1V8
ENSECAP00000020689 ENSECAP00000020689 9796.ENSECAP00000020689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]