SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020725 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020725
Domain Number 1 Region: 248-431
Classification Level Classification E-value
Superfamily vWA-like 2.49e-26
Family Integrin A (or I) domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020725   Gene: ENSECAG00000022862   Transcript: ENSECAT00000024925
Sequence length 1095
Comment pep:known chromosome:EquCab2:6:28786100:28890947:1 gene:ENSECAG00000022862 transcript:ENSECAT00000024925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWASLPKTAVMLWLLLSSTSPSPAWGQAEIPLEMVKLWADTFGGDLYKTVTKYSGSLLL
QKKYKDVEPSLKIKEVDGLELVRKFSEAMETMLRRKVEAVKNLVEAAEEADLNHEFNESL
VFDYYNSVLINERDENGNYVELGAEFVLESNAHFSNLLVNTSISSVQLPTNVYNKDPDIL
NGVYMSEALNPVFVENFQRDPTLTWQYFGSSTGFFRIYPGIKWTPDENGVIAFDCRNRGW
YIQAATSPKDIVIVVDTSGSMKGLRMTIAKHTITTILDTLGENDFVNIIAYSDHIHYIEP
CFRGILVQADRDNREHFKQLVDELMVKGVGVVNQALTEAFQILNQFQEARQGSLCNQAIM
LISDGAVEDYEPVFEKYNWPDRKVRVFTYLIGREVTFADRMRWIACNNKGYYTQVSTLAD
AQENVMEYLHVLSRPMVINHDHDITWTEAYMDSKLLTSQAQNVMLLTTVAMPVFSKKNET
RSHGILLGVVGSDVALRELMKLAPRYKLGVHGYAFLNTNNGYILSHPDLRPLYREGKKLK
PKPNYNSVDLSEVEWEDRAETLRAAMINGETGSLSLDVKVPLDKGRRALFLANDYFFTDI
SDTPFSLGVVLSRGHGEHILLGNTSVEEGLHDLLHPDLTLASDWIYCTTDIDPDHRKLSQ
LEAVVRFLTGEDPDLECDEELVQEALFDAVVTAPMEAYWTALALNISDESEHGVDVAFLG
TRAGLLRSSLFVGSEKVSDKKFLTPEDETSVFTMDRFPLWYRQAAEQPPGSFVFNLRSAE
GPESPGEPVAVTASTAVAVTVDEKTAIAAGRGPDMVTEWLQPRHFSSSFQCSPVDGPCPK
SCQDNDLDCFVIDNNGFILISEMSQEVGRFLGEVDGALMTQLLSMGVFSQVTMYDYQAMC
KLQNHHPSAARPLVSPVSALLTATRWLVNELLLFLLEWSAWGSWHVDRGAEAKAVFHHSH
KHKKQDTLQPCDTEYPVFVHQMAIRETNGVIECGACQKIFVMQQIPNSNLLLLVTDTTCD
CSIFPLILQEATEVKYILPCDRMRSQKLRRRPGSCHAFHPEENAQDCGGTSDTSASFTLL
LLPLCAWVLPPQLLW
Download sequence
Identical sequences F6U5C2
ENSECAP00000020725 ENSECAP00000020725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]