SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020734 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020734
Domain Number 1 Region: 1840-2084
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.09e-53
Family Ankyrin repeat 0.000000056
Further Details:      
 
Domain Number 2 Region: 430-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000201
Family EGF-type module 0.00045
Further Details:      
 
Domain Number 3 Region: 1139-1281
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000204
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 4 Region: 825-956
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000267
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 389-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000274
Family EGF-type module 0.00028
Further Details:      
 
Domain Number 6 Region: 723-764
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000235
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 7 Region: 598-726
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000298
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 8 Region: 949-1070
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000706
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 9 Region: 760-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000117
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 10 Region: 119-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000359
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 572-610
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000392
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 12 Region: 235-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family EGF-type module 0.017
Further Details:      
 
Domain Number 13 Region: 1110-1153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000504
Family EGF-type module 0.012
Further Details:      
 
Domain Number 14 Region: 155-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000547
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 15 Region: 266-394
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000549
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 16 Region: 82-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000237
Family EGF-type module 0.027
Further Details:      
 
Domain Number 17 Region: 198-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000039
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 18 Region: 1277-1321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000493
Family EGF-type module 0.016
Further Details:      
 
Domain Number 19 Region: 468-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000511
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 20 Region: 1458-1491
Classification Level Classification E-value
Superfamily Notch domain 0.000000085
Family Notch domain 0.0045
Further Details:      
 
Domain Number 21 Region: 1498-1530
Classification Level Classification E-value
Superfamily Notch domain 0.000000183
Family Notch domain 0.0043
Further Details:      
 
Domain Number 22 Region: 39-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000005
Family EGF-type module 0.014
Further Details:      
 
Domain Number 23 Region: 1360-1397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000116
Family EGF-type module 0.02
Further Details:      
 
Domain Number 24 Region: 1417-1449
Classification Level Classification E-value
Superfamily Notch domain 0.00000157
Family Notch domain 0.00026
Further Details:      
 
Domain Number 25 Region: 1078-1118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family EGF-type module 0.023
Further Details:      
 
Domain Number 26 Region: 1314-1354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000136
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000020734
Domain Number - Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000146
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 5-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000257
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 801-836
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0198
Family EGF-type module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020734   Gene: ENSECAG00000022405   Transcript: ENSECAT00000024936
Sequence length 2524
Comment pep:known chromosome:EquCab2:25:37430424:37476262:1 gene:ENSECAG00000022405 transcript:ENSECAT00000024936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSQPGESCLNGGKCEVLANGTEACICSGAFAGQRCQVPNPCLSAPCKNGGTCHMVDRGGL
VDYACSCSLGFSGPLCLTPQDNACLANPCRNGGTCDLLTLTDYKCRCPPGWSGKTCQQAD
PCASNPCANGGQCLPFEASYICGCPPGFHGPTCKQDINECSQSPGLCRNGGTCHNEVGSY
RCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTTHECACLPGFTGQNCEENIDDCP
GNSCKNGGACVDGVNTYNCRCPPEWTGMYCTEDVDECQLMPNACQNGGTCHNSHGGYNCV
CVNGWTGEDCSENIDDCASASCFHGATCHDRVASFYCECPHGRTGLLCHLNDACISNPCN
EGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKCINTLGSFECQCLQ
GYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLQN
GRCLDKINEFLCECPTGQAGHLAAYAHWGCPSLPCPPGLSLRGGPVCHRGGPGAHQAHRH
CRSEPWASRDDGVATFTCLCRPGYTGHHCETNINECHSQPCRHGGTCQDRDNAYLCFCLK
GTTGPNCEINLDDCASNPCDSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGG
TCEDGINGFTCRCPEGYHDPTCLSEVNECNSDPCIHGACRDSLNGYKCDCDPGWSGANCD
INNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVA
GYKCNCLLPYTGATCEVVLAPCAPGPCRNGGECRESEDFESFSCVCPVGWQGQTCEIDIN
ECVKSPCRHGASCQNTNGGYRCHCQAGYTGRNCETDIDDCRPNPCHNGGSCTDGINAAFC
DCLPGFQGAFCEEDINECASSPCRNGANCTDCVDSYTCTCPPGFGGIHCENNTPDCTESS
CFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSRPCLHGGTCQDSYGTYKCTCPQGY
TGLNCQSLVRWCDSSPCKNGGKCWQTNALYRCECHSGWTGLYCDVPSVSCEVAARLQDVN
VSRLCRNGGLCENEGSTHHCHCQAGYTGSYCEDQVDECSPSPCQNGATCTDYPGGYSCEC
VAGYHGVNCSEEINECLSHPCQNGGTCIDLTNSYKCSCPRGTQGVHCEINMDDCTPPVDP
VSRGPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDARGTQNCVQRVNDF
HCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICRCPAGYEGATCENDARA
CGSLRCLNGGTCISGPRSPTCLCLGPFTGPECQFPASSPCVGGNPCYNQGTCEPTSESPF
YRCLCPAKFNGLLCHILDYSFGGGVGLDIPPPQIEEACELPACREEAGNKVCSVRCNNHA
CGWDGGDCSLNFNDPWQNCTQSLQCWKYFSNGHCDSQCNSAGCLFDGFDCQRAEGQCNPL
YDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNNSFH
FLRELSRLLHTNVVFKRDASGQQMIFPYYGREEELRKHPIRRSVDGWATPGSLLGHMKAS
LLPGSGGGRQRRELDPMDIRGSIVYLEIDNRQCVQSSSQCFQSTTDVAAFLGALASLGSL
NIPYKIEAVQSESVEPPPPPPLHFMYVAVAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEG
FKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQNEWGDEDLETKKFRFEESVVLP
DLDDQTDHRQWTQQHLDAADLRVSAMAPTPPQGEADTDCMDVNVRGPDGFTPLMIASCSG
GGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASA
DANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLE
DLINSHADVNAVDDLGKSALHWAAAVNNVEAAIVLLKNGANKDMQNNKEETPLFLAAREG
SYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEYSLVRSPQLHGATLGGT
PTLSPPLCSPNGYLGNLKPTVQGKKARKPSTKGLACGGKEAKDLKARRKKSQDGKGCLLD
SSSVLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSVPLNHLPGMPDTHLGVSHLSVAAK
PEMATLGGGGRLAFEAGPPRLSHLPVASSTSTVLGPGGGSGVMNFTVGGATGLNSQCEWL
SRLQNGLVPNQYNPLRGSVAPSTLSTQAPALQHGMMGPMHGGLSASALSQMMSYQALPNT
RLATQPHLVQTQQLQQQQQQQQPQQNLQPPNIQPQQNLQPQPPPPHLGVSSAANGHMGRS
FLGGEPSQADVQPLGPSSLAVHTILPQDSQVLPTSLPSSLAPPMTTAQFLTPPSQHSYSS
SPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGISSPPTSMQSQIAHIP
EAFK
Download sequence
Identical sequences F6TZ18
9796.ENSECAP00000020734 ENSECAP00000020734 ENSECAP00000020734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]