SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020775 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020775
Domain Number 1 Region: 2980-2994,3022-3217
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000251
Family Galacturonase 0.064
Further Details:      
 
Domain Number 2 Region: 2220-2434
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000402
Family Galacturonase 0.029
Further Details:      
 
Domain Number 3 Region: 1014-1100
Classification Level Classification E-value
Superfamily E set domains 0.00000000675
Family E-set domains of sugar-utilizing enzymes 0.029
Further Details:      
 
Domain Number 4 Region: 257-314
Classification Level Classification E-value
Superfamily E set domains 0.0000000777
Family E-set domains of sugar-utilizing enzymes 0.073
Further Details:      
 
Domain Number 5 Region: 1195-1251
Classification Level Classification E-value
Superfamily E set domains 0.000000369
Family E-set domains of sugar-utilizing enzymes 0.035
Further Details:      
 
Domain Number 6 Region: 927-998
Classification Level Classification E-value
Superfamily E set domains 0.000000665
Family E-set domains of sugar-utilizing enzymes 0.085
Further Details:      
 
Domain Number 7 Region: 1569-1642
Classification Level Classification E-value
Superfamily E set domains 0.00000102
Family E-set domains of sugar-utilizing enzymes 0.052
Further Details:      
 
Domain Number 8 Region: 347-402
Classification Level Classification E-value
Superfamily Anthrax protective antigen 0.00000196
Family Anthrax protective antigen 0.015
Further Details:      
 
Domain Number 9 Region: 1384-1467
Classification Level Classification E-value
Superfamily E set domains 0.00000356
Family E-set domains of sugar-utilizing enzymes 0.037
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000020775
Domain Number - Region: 1481-1557
Classification Level Classification E-value
Superfamily E set domains 0.000133
Family Other IPT/TIG domains 0.06
Further Details:      
 
Domain Number - Region: 1735-1788
Classification Level Classification E-value
Superfamily E set domains 0.0342
Family Other IPT/TIG domains 0.09
Further Details:      
 
Domain Number - Region: 1104-1182
Classification Level Classification E-value
Superfamily E set domains 0.0777
Family E-set domains of sugar-utilizing enzymes 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020775   Gene: ENSECAG00000022699   Transcript: ENSECAT00000024985
Sequence length 4076
Comment pep:known chromosome:EquCab2:20:49361585:49771423:-1 gene:ENSECAG00000022699 transcript:ENSECAT00000024985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTWLISLISIETLLLAVPYLSFHIEPEEGSLAGGTWITVIFDGRLGLLYPANGSQLEIH
LMSAAVPALPSIPCDVVPVFLDLPVVMCRTRSLPSEAHEGLYYLEAHSQGQVASSSTPGP
QDSPTFKFSRAQTPFVYQVNPPSGVPGELIQVYGWIITRRSETFDFDAEYIDSPLILEAQ
GDRWVTPCSLVNRQTGSRYPVQEHHGLGTLQCRVEGHYIGSQNVSFSVFNKGKSMVHKNA
WLISANQDLFLYQTYSEILSVVPETGSLGGRTDITITGAFFDNPAQVTIAGIPCDIRHVS
PRKIACTTRAPGKGTRLTAPQAGNRGLLFEVGDAAEGLDLTEATPGYRWQIVPNASSPFG
FWSKEGQPFRARLSGFFVAPETNNYTFWIQADSQATLYFSQSEDPRTKVKVASIRVGTAD
WFDSWEQKGNEGTWQQKTPKLELFGGARYYLEAEHHGRAPSRGMRIGVQIHNTWLNPDVV
STYLQEKHQIRIRAQRLPEIQMLTVSGRGNFLLTWDNVSSQPIPANATAHQIQTALEELL
AVKCKLEPLSANILFRLGFEEGPEGSSSDGDLTSGTEPFCGRFSLYQPRHLVLTPPAAQK
GYRLDQYTHLCMAYKGHMNTILKVTVSFTVDFQNVAKNITCDWRLEGTSPNSWQFTCTDL
WNTCVHRSTDLQPPLASSPALVHLIDLLPLSQEPGVFYMDEIVIADTNLTVSQADSGTAR
PGGNLVELLSVVGSPPVYNVTCWLAGCGPELPLISASSVPTEGAEERSGLVHVTTQRLQR
TSLPLGGHFRIQLSNTVIPDVPVHISASHLHKLLRNNADDFTARYLNVSDFSVMEDLKSC
YERVWTLSWSAQVGDLPNFIRVSDENLTGVNPVATTRVVYDGGVFLGPIFGDMLVTANRC
PQVVVRVNDIPAHCSGSCSFRYLEASTPRVHSVCYSPDGDTDLLVYITGTSFSGDYKALQ
VTVNKTSCKVIFSNQTNVVCQADLLPVGVHQISMLVRPSGRAINASGGGLFLNVEPRLDA
VEPSRAAEIGGLWATIRGSSLEDVSLVLFGSQSCVINVTTSNSRRIQCKVPPRGKDGHVV
NVTVIREDHSTVLPMAFTYDSSLNPVITSLSRNRSSIAGGETLFIGMALLVNDTDLDVQV
HIQETLAPVHEQMAQGLEVVLPLLPAGLHRISVSINGVNISSQGVDLHIHCITEVFSIEP
CCGSLLGGTILSISGIGFSRDPALVWVLVGNQSCDIVNSTERNIWCETSPASLLPDADDL
SVPAPVEVWAGSTSISRAPSPSLVGKGFIFMYEVAATPVVTAVRGEITDSSLRLDVEGSN
LSNSVILLGGLACGLETQSFRSNVSLSGCSFPLHSLEAGIYPLQVRQKQMGFANMSAVPQ
QFVVTPRITAIFPAHGSACGGTVLTVQGLALSSRRGSVQVDLSGPFTCVILSLGDQTVLC
QIHLVGDPLPGASFTLNVTVLVNELPSECQGDCTLFLREETTPVVDALTTNISGSLTTVL
IRGQRLGTTADEPVVSVDDHLLCNVTFFNASHVTCWISGLTPGPHYLSVFHRRNGYACSG
NVSRHFDILPQVFRYFPKNFSIHGGGLLTVEGTALRGQNATLVYVGWQACLTVNVSSDLI
QCIVPSGNGSVALNIEVDRLSHQMGVISYSNTFTPELLSLSQTDDVLTFAVAQISGAMNV
DILIGMSPCMNVSGNRTVLQCVVPSLPAGEYQVRGYDRTRGWASSALVFTSRVSVTAVTQ
NFGCLGGRLVHVSGAGFPPENISAAVCGAPCQVLANATVSAFSCLVLPLDVSLAFLCGLK
HEEEGCDASSRTYVQCDLTVTVGTESLLSSWPYFYICEESPSCLFAPGHWTESASPWFSG
LFISPKVERDEVLIYNSSCNITMETEAKMECETPNQPITAKITEIRESRAQNTQGNFSFQ
FCRRWSRAHSWFPERVPQDGDNVTVEKGQLLLLDTNTSILNLLHVKGGKLIFMDPGPIEL
RAHSILVSHGGELRIGSKDKPFQGKAEIKLYGSSHSTPFFPYGVKFLAVRNGTLSLHGLL
PEVMVTHLRAAAYARDTVLALEDAVDWHPGDEVVIISGIGVAGAKPMEEIVIVETVHNAD
LHLRSPLRYSHNFTENWVAGEHHILKVMVVLLSRNITIRGNLTNERMKLLASCQEASASE
GNLQNCLYSKSEKMLGSRDLGARLIVQSLPGEPSRVQLKGVLFRELGQAFRKHLSSLTLV
GAMRDSYLQGCTVWGSFSRGLSMSRTLGLKVTSNVFYNILGHALLVGTYMEVRYILWEAM
PTRKNDESEQGSIIRNNVIIRVSGAEGLSSPEVLTPSGIYIRNPTNVVEGNRVCAAGYGY
FFHLVTSRTSQAPLLSFTGNVAHSCTRYGLFVYPKFQPPWDDGTGPTLIQNFMVWGGAGG
AQIFRSSNLLLKNFQIYSCRDFGIDILESDANTSVTDSLLLGHFAHKGSLCMSAGIKTPK
RQELVVSNTTFVNFDLTECVAIRTCSGCSRGQGGFTVKTNQLKFTNSPNLVAFPFAHAAI
LEDLDGSLSGKNRSHILASMETLSASCWVNTSFSQVVSGSVCGEDVLFHRMSIGLANAPD
VSSDLTMTDSRNKTTTVNYVRDTLSNRYGWMALLLDQEMYSLRFETPWISRSLQYSATFD
NFAPGNYLLLVHADVWPYPDILMWCGSHVGRSLPSLPSPGRDQGCDWFFDSQLRQLTYLV
SGEGQVRVILQVKEGVPPTISASTSVPESALKWSHPEAWTGVEEGWGGHNHTTPGPGDDV
LILPNRTVLVDTDLPFLKGLYVMGTLEFPVDRSNILSVACMVIAGGELKVGTLENPLEKE
QKLLILLRASEGVFCDRFDGIHIDPGTIGVYGKVQLHSAYPKKSWTHLGADIASGNERII
VEDAVDWRPHDKIVLSSSSYEPHETEVLTVKEVKGHHVRLHERLKHRHIGNVHVMEDGRY
IRLAAEVGLLTRNIQIQSDTSCKGRLRVGSFRKSSREEFSGVLQLSNVEIQNFGSPLYSS
IELTNVSAGSWIISSTLHQSCSGGIHAVASHGIILNDNIVFGTAGHGIDLEGQAYSLSNN
LVVLMTQSAWSTVWVAGIKVNRAKDINLRGNVVAGSERLGFHIRGHSCSSPEALWSDNVA
HSSLHGLHFYQESGLDNCTGISGFLAFKNFDYGAMLHVENSVEMENITLVDNAVGLLAVV
YVSSVPQSSIGNVQIVLRNSVIVATSSSFDCIQDRIKPCSANSTSTDRAPSNPKGGRIGI
LWPAFTSEPNQWPQEPWHKVRNGHSVSGIMKLQDVTFSSFVKSCYSDDLDVCILPNAENV
GIMHPITAERTRMLKIKDKNKFYFPPLQTRKDLGILVCPELDCESPRKYLFKDLDGRALG
LPPPVSVFPKIEAEWTGSFFNTGTFREEQKCVYRPLIQGYICKQTDQVILILDNADATWA
MRKLYPVVSVTSGFVDTFSSVNANTPCSTSGSVSTFYSILPTREITKVCFVDQTPQVLRF
FLLGNKSTSKLLLAVFYHELQSPQVFLGGSFIPPTLVQSTSSLLDEPIGSNYFSIMDNLL
YVVLQGEEPVEILSDASLHLVLTVMFSILEKGWEVMFFERLTEFLQIGQDQIRFTHEMPG
NEATLKAIADSRTKRKRNCPTVTCANHYRAGRRRPLMIEMSSHRVPPPTTTEPISKVMVI
EIGDLPTVKSTGPIPSLSSNKLQNLAHQIITAQQTGLLENVLNMTIGGLMVTQSKGVIGY
GNTSSFKTGNLIYIRPYALSVLVQPSDGEVGKELPVQPQLVFLDKQNRRVESLGTPSEPW
AVSISLEGTSDSVLKGCTQAEAQDGYVRFSNLAVLISGSNWHFIFTVISPPGVNFTARSR
PFAILPVTRSESSTIILAASLCSVVSWLALCCLVCCWFKKSKSRKIKSEEISESQTNDQK
NPTHVPSKRQGSQVETGKEDAVMGEDMRKKVMLGKLNQLPHQSLNGVSRRKVSRRTVGEE
HGSQEGAAVPAPNLTSLTSHGHTCAPGSPARQVCVQETGNWKKAQEQLLRYQLAGQDQLL
LLCPDLRQERQRMQGQSQLGKEGGRLGLSQEKKTSCGATESFCLHSVRPETIQEQL
Download sequence
Identical sequences F6TQL1
9796.ENSECAP00000020775 ENSECAP00000020775 ENSECAP00000020775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]