SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020918 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000020918
Domain Number - Region: 37-158
Classification Level Classification E-value
Superfamily E set domains 0.00133
Family Arrestin/Vps26-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020918   Gene: ENSECAG00000023493   Transcript: ENSECAT00000025153
Sequence length 334
Comment pep:known chromosome:EquCab2:7:42359415:42378735:1 gene:ENSECAG00000023493 transcript:ENSECAT00000025153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFGVGQSVEVQIVLNDAESRKRAEHKTEDGKKEKYFLFYDGETVSGKVSLALKNPNKRLE
HQGIKIEFIGQIELYYDRGNHHEFVSLVKDLARPGEISQSQAFDFEFTHVEKPYESYTGQ
NVKLRYFLRATISRRLNDVVKEMDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNKSK
YHLKDVIVGKIYFLLVRIKIKHMEIDIIKRETTGTGPNVYHENDTIAKYEIMDGAPVRGE
SIPIRLFLAGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVRKS
MSHQAAIASQRFEGTTSLGEVRTPSQLSDNSSRQ
Download sequence
Identical sequences F6USC4
9796.ENSECAP00000020918 ENSECAP00000020918 ENSECAP00000020918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]