SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020960 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020960
Domain Number 1 Region: 173-419
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 1.31e-81
Family Oxidoreductase molybdopterin-binding domain 0.00000000847
Further Details:      
 
Domain Number 2 Region: 422-543
Classification Level Classification E-value
Superfamily E set domains 6.58e-39
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.0000056
Further Details:      
 
Domain Number 3 Region: 83-164
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 1.44e-21
Family Cytochrome b5 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020960   Gene: ENSECAG00000023522   Transcript: ENSECAT00000025200
Sequence length 545
Comment pep:known chromosome:EquCab2:6:73698997:73712591:1 gene:ENSECAG00000023522 transcript:ENSECAT00000025200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLHRAVVSAFRHACRFKSTSSKLCIQACSTNDSFQPQCPSLTFSGNNSSTRGWRVMGT
LLGLGAVLAYHDHRCKAAQELPRIYTREEVRSHSSPETRIWVTLGSEVFDVTEFVDLHPG
GPSKLMLAAGGPLEPFWALYAVHNQSHVREILAQYKIGELSPEDKAPSTLKTSDPYADDP
IRHPALKVNSQRPFNAEPPPELLTENYITPNPIFFTRNHLPVPNLDPDTYRLHVEGPPGG
QSLSLSLDDLYQFPKHEITVTLQCAGNRRSEMTQVKEVRGLEWSIGAISTARWAGARLCD
VLAQAGHQLCETEAHVCFEGLDSDPTGTAYGASIPLARAMDPEAEVLLAYEMNGQPLPRD
HGFPVRVVVPGVVGARHVKWLGKVSVASEESYSHWQRRDYKGFSPSVDWDTVDFDSAPSI
QELPVQSAITEPKDGATVESGEVTIKGYAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQ
CPRKAWAWRLWELQAPVPAGQKELNIVCKAIDDSYNVQPDTMAPIWNLRGVLSNAWHRIH
VHVHP
Download sequence
Identical sequences F6UC66
9796.ENSECAP00000020960 ENSECAP00000020960 ENSECAP00000020960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]