SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021012 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021012
Domain Number 1 Region: 35-357
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6e-118
Family Bee venom hyaluronidase 0.0000044
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000021012
Domain Number - Region: 421-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00262
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021012   Gene: ENSECAG00000023576   Transcript: ENSECAT00000025263
Sequence length 482
Comment pep:known chromosome:EquCab2:4:79608188:79616563:1 gene:ENSECAG00000023576 transcript:ENSECAT00000025263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCNPLVGWLGMLLLLTVFTHSALKPAMPPVIKHQPFNIFWAAPTIQCEHFFNVDLNLPLF
NILSNPLETQSGSTIAIIYPNQLGYYPYFSQDGKSFNGGIPQNMSLSKHLRKTADDIAKI
VPWWRSEGLVVIDWESWKPQWDRNWGNRMIYKNYSLAFTRNHHPDWSEMKVKTVAQKEFE
NAGRSFMNTTLALALEMRPKCLWGFYLYPDCYNYDYRINPQIYTGKCPNDEIFHNDQLQW
LWEKSTALYTSIYLDKILKSSLNALKFVHYRVREAMRVAEMATHDYVLPVFIFSRPFYLH
SLEALSQEDLVHTIGESAALGAAGIILWGGYEYANSKEACLSVQKSIQGPLGHYAVNVTS
AAKLCSQSLCNNNGRCVRKTLESSSYLHMPESSSKKYVLNKSFKFLISPVNKLKTIKDMK
NAFVCHCYYGWHGESCQQRPPDLLRGKNKASMANFNFSVFLSVPLSVILLNFFTPTTMSI
FP
Download sequence
Identical sequences F7CV46
9796.ENSECAP00000021012 ENSECAP00000021012 ENSECAP00000021012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]