SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021020 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021020
Domain Number 1 Region: 50-131
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000811
Family V set domains (antibody variable domain-like) 0.077
Further Details:      
 
Domain Number 2 Region: 150-232
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000582
Family I set domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021020   Gene: ENSECAG00000023610   Transcript: ENSECAT00000025272
Sequence length 309
Comment pep:known chromosome:EquCab2:10:20913940:20920489:-1 gene:ENSECAG00000023610 transcript:ENSECAT00000025272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIWNLEEKDYTQLVYNILKGTAYLFYADLGEHKRAFLRENIELSVSDLIQKPELHIPEIL
VAEEPVTLTCTFKGTCKETKAPLLSWKEPTTPSNTDSSSNSSTSSSVLHPEDHGTTIRCH
LNFSLANLTKSSMLKLQAVSPPRLLYSSCSLKKTLQCSCSFQGIPTPSVQWLMDRVPVSV
NSMSNILHMTSSVSVPWANSTISLTGDPEIVTKLHCEGKNEYGIHTSSIFLIPHKNSVSN
VFMKGLIQGVVYGSIASALLCFFFVLLTMKILKWWEETQIPKAKEALILKEPEPLEEPET
PKESEAETP
Download sequence
Identical sequences F7CUZ8
ENSECAP00000021020 ENSECAP00000021020 9796.ENSECAP00000021020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]