SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021112 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021112
Domain Number 1 Region: 3316-3427
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-30
Family Cadherin 0.00092
Further Details:      
 
Domain Number 2 Region: 1125-1258
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-30
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 3007-3115
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-28
Family Cadherin 0.00073
Further Details:      
 
Domain Number 4 Region: 2266-2371
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-28
Family Cadherin 0.0013
Further Details:      
 
Domain Number 5 Region: 2792-2900
Classification Level Classification E-value
Superfamily Cadherin-like 8.11e-27
Family Cadherin 0.0014
Further Details:      
 
Domain Number 6 Region: 1029-1130
Classification Level Classification E-value
Superfamily Cadherin-like 1.13e-25
Family Cadherin 0.00084
Further Details:      
 
Domain Number 7 Region: 3764-3930
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-24
Family Laminin G-like module 0.004
Further Details:      
 
Domain Number 8 Region: 3415-3533
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-24
Family Cadherin 0.002
Further Details:      
 
Domain Number 9 Region: 2058-2165
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 10 Region: 814-917
Classification Level Classification E-value
Superfamily Cadherin-like 1.4e-23
Family Cadherin 0.00078
Further Details:      
 
Domain Number 11 Region: 446-544
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-23
Family Cadherin 0.00098
Further Details:      
 
Domain Number 12 Region: 1438-1562
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-23
Family Cadherin 0.0017
Further Details:      
 
Domain Number 13 Region: 708-820
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-22
Family Cadherin 0.0014
Further Details:      
 
Domain Number 14 Region: 919-1022
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-22
Family Cadherin 0.0021
Further Details:      
 
Domain Number 15 Region: 3104-3213
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-22
Family Cadherin 0.0033
Further Details:      
 
Domain Number 16 Region: 1549-1650
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-21
Family Cadherin 0.0013
Further Details:      
 
Domain Number 17 Region: 2475-2585
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 18 Region: 1230-1338
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-20
Family Cadherin 0.0033
Further Details:      
 
Domain Number 19 Region: 136-229
Classification Level Classification E-value
Superfamily Cadherin-like 3e-20
Family Cadherin 0.0028
Further Details:      
 
Domain Number 20 Region: 2165-2272
Classification Level Classification E-value
Superfamily Cadherin-like 3.8e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 21 Region: 2902-3013
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-20
Family Cadherin 0.0043
Further Details:      
 
Domain Number 22 Region: 1752-1872
Classification Level Classification E-value
Superfamily Cadherin-like 2e-19
Family Cadherin 0.0019
Further Details:      
 
Domain Number 23 Region: 1648-1770
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-18
Family Cadherin 0.0026
Further Details:      
 
Domain Number 24 Region: 2373-2481
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-18
Family Cadherin 0.0017
Further Details:      
 
Domain Number 25 Region: 2573-2682
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-18
Family Cadherin 0.0025
Further Details:      
 
Domain Number 26 Region: 3213-3314
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-17
Family Cadherin 0.003
Further Details:      
 
Domain Number 27 Region: 557-658
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000733
Family Cadherin 0.0032
Further Details:      
 
Domain Number 28 Region: 2689-2799
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000971
Family Cadherin 0.0024
Further Details:      
 
Domain Number 29 Region: 1860-1982
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000214
Family Cadherin 0.006
Further Details:      
 
Domain Number 30 Region: 1967-2070
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000157
Family Cadherin 0.0025
Further Details:      
 
Domain Number 31 Region: 1349-1437
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000353
Family Cadherin 0.0072
Further Details:      
 
Domain Number 32 Region: 362-458
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000419
Family Cadherin 0.0087
Further Details:      
 
Domain Number 33 Region: 3948-3986
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000256
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 34 Region: 32-148
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000597
Family Cadherin 0.0052
Further Details:      
 
Domain Number 35 Region: 3529-3621
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000157
Family Cadherin 0.015
Further Details:      
 
Domain Number 36 Region: 3982-4024
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021112   Gene: ENSECAG00000023329   Transcript: ENSECAT00000025380
Sequence length 4349
Comment pep:known chromosome:EquCab2:14:26606940:26664942:1 gene:ENSECAG00000023329 transcript:ENSECAT00000025380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVIALLGVAVFLLRCTSCEKPQEEIISSSAWHFTHPLYNATIYENSAPKTYVESSVKMGI
YLAEPQWAVKYRIISGDVANVFKTEEYVVGNFCFLRIRTKSSNTALLNREVRDSYTLIVQ
ATEKTLELEALTRVVVHILDQNDLKPLFSPPSYRVTISEDMPLKSPICKVTATDADLGQN
AEFYYAFNTRSEMFAIHPTSGVVTLAGKFNVTWRGKYELQVLAVDRMRKISEGNGFGNLA
ALVIHVEPALRKPPAIVSVVVAPPNSHEDAPYATVVVDANSSGAEVDSLEIVDGDPGKYF
KAIKSYARSSEFSLVSVKDINWMDHLHGFNLSLQARSTSTPSFYSQIRAFHLPSSKLASL
QFEKAVYRVQLSEVSPPGSRVAMVKVTPAFPNLQYVLKPSSDSAGFKLNARTGLITTTKL
MDFRDRAHYQLHIRASPGLASTTVVVDIVDCNNHAPIFNRSSYEGTFDENIPPGTSVLTV
TATDRDHGENGYVTYSIARPKSVPFSIDPYLGIISTSKPMDYELMKRIYTFRVRASDWGS
PFRQEKEVSVSLRLRNLNDNRPMFEEVNCTVAIREDWPVGKSVMTVSAIDVDELQNLKYE
FVAGNALEYFDLNHFSGVISLKRSFVNHTTGQSINYSLKITASDGKNYASPTTLNVTVVK
DPRLEVPVRCDKTGVLTHFTKTILHSVELQNQDSNDEDFTSLSAYQVNHHTPQFEDHFPQ
SVDILESVPLNILLARLAATDPDTGFNGKLVYVIADGNEEGCFDIELETGLLTVAAPLDY
EATSFYILNVTVYDLGTPQKSSWKLLTVNVKDWNDNAPRFPPGGYQVTISEDTEIGTTIA
ELKAKDADSEDNGRVRYTLLSPTDKFSLHPLTGELVVTGHLDRESEPQYILKVEARDQPR
KGHQLFSVTDLTITLEDANDNSPQCIMELHSLKVPEDLPPGTVLTFLDAYDPDLGPAGEV
QYTLLDDARGTFHVDPSTGVLSLEKELDFERRAGYNLSLWVSDSGRPLARRTLCHVEVIV
LDVNENLHPPRFASFVHQGQVQENSPSGTQVMGVTAHDDDSGLDGELQYSLRAGTGLAAF
SIDQDTGVILTLAPLDREFVSCYWLTVQAVDSGSVPLSSVTEVYIEVMDVNDNSPRMSRP
VFYPSVREDAPLYTSVLQLDAWDPDSSSKGKLTFNITGGNHMGFFVVHPLTGLLSTARQL
DRENKDEHILEVTVQDNGEPSLRSTSRVVVRILDVNDNPPVFSHKLFNVRLPERLSPGTP
GPVYRLVASDLDEGLNGRVTYSIEESDDEGFSIDPVTGVVSSSSTFKAGVYNILTIKATD
NGQPPLSASVRLHIEWIPPPRPSSIPLAFDELHYRFTVMETDPVNHMVGVISVEGRPGLF
WFSISGGDKDMEFDIEKTTGSIVIAKPLDTRRKLSYNLTVEVTDGSQAIATQVHIFVIAN
VNHHRPQFLEAHYEVRVPQDTLPGVELLRVQATDQDEGKGLIYTIHGSLDPRSASLFQLD
PSSGVLVTVGKLDLGSGLSWHTLTVMVRDQEMPIKRNFVWVSIHVEDGNLHPPRFTQLHY
ETNVTDTTAPGTELLQVRAMDGDRGDNAEVHYSLLKGNSEGFFNIDALLGIITLAQKLGK
TNHVQYTLTVKAEDQGSPQWHDLATVIIHVYPSDSSAPIFSKAEYFVEIPESIPVGSPIL
LVSAASSSEVTYELREGNKDGVFSMNSYSGLIATQKNLDHEKISSYQLKIRGSNMAGAFT
DVVVLVYIIDENDNAPMFLKLTFVGQISEAAPLNSMIVDENNNPVVIRASDSDKEANSLL
VYKILDPEALKFFKIDPSMGTLTIILKMDYESMPSFQFSIYVHDQGSPILFAPRPAHVII
NVRNVNDSPPRFSDQIYEVALVAPIHLGMELLTVRASDDDSEVNYSIKTGNADEAVAIHP
IAGRISVLNPAFLGLNRELIIRASDGLYQDTALVKIFLTQALNTSLRFDQDVYRATVKEN
LRDRKALVILGGQGSHLNDTLSYFLLNGTDMFHMIKSAGVLQTRGVAFDREQQDIHEVAV
ELRDNRTPQRVAQALVRVFVQDVNDNHPEFKHLPYYTIIQDGTEPGDVLFQVSATDQDLG
VNGAVTYAFAEDYTYFRMDPYLGDISLRKPFDYQALNKYHLKVIARDGGTPSLQTEEEVI
VIVRNKSNPLFQSPYYKVRVPENITLYTPILHTQARSPEGLRLIYNIVEEEPLRLFTTDF
KTGVLTVTGPLDYESKTKHTFTVRATDTALGSFSEATVEVLVEDINDNPPTFSQSVYTTS
ISEGLPAQTPVIQLLAFDQDSGQNRDVSYQIVEDGSDVSKFFQINGSTGEMSTVQELDYE
AQQHFHVKVRAMDRGDPPLTGETLVVVNVSDINDNPPEFRQPQYEANVSELATCGHLVLK
VQALDPDSRDISRLEYLILSGNQDRHFSINSSSGIISMLNLCKKHLDSSYSLRVGASDGV
FQATVPVYINTTNANKYSPEFQQHVYEAELAENAKVGTKVIELLAIDKDSGPYGTVDYTI
INKLADEKFSINPSGQITTLQKLDRENSTERVIAIKVMAQDGGGRVAFCTVKIILTDEND
NPPQFKASEYTVSVQSNVSKDSPVIQVLAYDADEGRNADVTYSVDSMEDLDEEVVEINPT
TGVVKVKESLVGLENRAFDLKIKAQDGGPPHWNSLVLLRLQVVPNEVSLPKFSEPLYSFS
ASEDLPEGSEIGSVKAVAAQDPVIYSLVQGTTPESNKDGTFSLDRNTGVLKVRKAMDYES
TKWYQIDLMAHCPHNDTYLVSLVSVNIQVKDVNDNRPIFEADPYKAVLTENMPVGTTVIQ
VTANDQDTGNDGQVSYRLPVDPGSNIHELFAIDSETGWITTLQELDCETRQTYRFYVVAY
DHGRTIQLSSQVLVEVSITDENDNAPQFASEDYRGSVVENSEPGEPVATLKTLDADVSEQ
NRQVTCYITEGDPLGQFGISQVGDEWRIFSRKTLDREQMAKYLLRITASDGKFQASVLVE
IFVLDINDNSPQCSQLLYTGKVSEDVSPGHFILKVSATDLDSDTNAQITYSLHGPGADEF
KLDPHTGELTTLTALDREKKDVYSLVAKATDGGGQSCQADVTLHVEDVNDNAPRFFPSHC
AVAVFDNTTVKTPVAVVLARDPDQGTNAQVVYSLTDSAEGHFSIEATTGVIRLEKPLQVR
PQAAELTVRASDLGTPIPLSTLGTVTVSVVGLDDYLPMFLNTEHSVQVPEDAQLGTEVLQ
LATLTRPGAEKTGYRVVSGNEQGRFRLDPRTGILYVNRSLDFETNPKYFLSIECSRKGSS
SLSDMTTIVVNITDTNEHRPRFLQDLYSTRVLENAVVGDLVLTVSATDEDGPVNSAITYS
LVGGNQLGHFTIHPKKGELKVAKALDWEQTSSYSLRVRATDNGRPPLHEDTDITIQVVDV
NDNPPRFFQLNYSTSVQENSPVGSKVLQLILSDPDSPENGPPYSFRITKGNDASAFHVTP
DGWLVTMAGLSRRVQEWYQLQIEVSDSGIPPLSSSTSVRVHVMEQSRYPPSALPLEIFIT
TGEEEFQGGMVGKIHATDRDPQDTLTYSLAGGETRDRRFSVGAPDGKIIAAPGLPRGRYA
FNVTVSDGTFTATAGVHVHVWHVGEALQQAMWMGFHQLTPEELVSDHWRNLQRFLSNKLD
IKRANIHLASLQPAEAMAGVDVLLVFEGHSGTFYKLQELASIITRSAKEMEHSVGIQMRS
AMPVVPCQGPSCQGQMCQETVHLDPRVGPTYSTARLSILTPRHRLERNCSCNGTAVRFSG
QSFARYSLPEAQNWHIRFRLKTLQSQAILLFSNETVRVSVKLVDGVLWLEYGCPSGFYGN
LSSWLHVNDQQWHTILLEEMDTAIRLLVDSAGNATLVLPETCRGRRPERDLFLGGRVLLH
SSPKVSRGFEGCLDAVVINREALELLAHGKKAVGLLERQALTHCCFHSEECSQNPCLNGG
KCSHTHGAGYVCQCPPQFSGKHCEQRRENCTSTPCLEGGTCISSPEGASCNCPHPYTGDR
CEMEARGCSEGHCLVTPEIKRGDWGQQEILIIIFALLLITVCTAGLLFYCRRCKSHKPVA
MEDPDLLARSVGVDTQAMPAIELNPLSTSSCDNVNQLEPSKTSVPNELVTFGPSSKQRPV
VCSVPPRLPPAVVPSHSDNESIIKRTWSGEDMVYPGGVAVWPPTYSRKECWEYPHPDVAP
GPLPPSPHRHQTPAVMPDPTGLYGGFPFPLEMENKRAPLPPRYSNQNLEDLMPPRAPSPR
EHLLAPCLNEYTAISYYHSQFRQGGGGPCLAEGGSKGVSMRLSRAGPSYADCEVGGGIPT
GRGQPQAPPNYEGSDMVESDYGSCEEVMF
Download sequence
Identical sequences F7C8D7
ENSECAP00000021112 9796.ENSECAP00000021112 ENSECAP00000021112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]