SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021136 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021136
Domain Number 1 Region: 615-912
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-83
Family Protein kinases, catalytic subunit 0.00000000107
Further Details:      
 
Domain Number 2 Region: 29-201
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-73
Family Ephrin receptor ligand binding domain 0.000000891
Further Details:      
 
Domain Number 3 Region: 325-530
Classification Level Classification E-value
Superfamily Fibronectin type III 1.61e-40
Family Fibronectin type III 0.0000715
Further Details:      
 
Domain Number 4 Region: 909-979
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000381
Family SAM (sterile alpha motif) domain 0.0019
Further Details:      
 
Domain Number 5 Region: 254-317,363-379
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000336
Family Growth factor receptor domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021136   Gene: ENSECAG00000023211   Transcript: ENSECAT00000025408
Sequence length 984
Comment pep:known chromosome:EquCab2:26:1293607:1656884:-1 gene:ENSECAG00000023211 transcript:ENSECAT00000025408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCHLSVLLLLSCSALGCSGEVTVPPSNEVNLLDSKTVQGELGWISYPSHGWEEISGVDE
HYTPIRTYQVCNVMDHSQNNWLRTNWVSRNSAQKIYVELKFTLRDCNSIPLVSGTCKETF
NLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEVREVGPVNKKGFY
LAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDAP
RMYCSTEGEWLVPIGKCSCNAGYEEGGLMCRACRPGFYKASDGGMKCAKCPPHSSTPEDG
SVNCRCENNYFRADRDPPSMACTRPPSAPRNVISNINETSVILDWSWPLDTGGRKDVTFN
IICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAINGVSELSS
PPRQFAAVSITTNQAAPSPVITIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQ
ETSYTILRARGTNVTISSLKPDTTYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGENS
QVVMIAVSAAGAILLLSGVAYVLIGRFCGYNKSKHGAEEKRLHFGNGHLKLPGLRTYVDP
HTYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGY
TEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDGFLRKHDAQFT
VIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAY
TTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDE
GYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKVVTSAAARPS
NLLLDQSNVDVPTFRTPGDWLNGVRTAQCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVV
GPQKKIISSIKALETQSKNGPVPV
Download sequence
Identical sequences F7C3U9
9796.ENSECAP00000021136 XP_001501477.1.31192 ENSECAP00000021136 ENSECAP00000021136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]