SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021147 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021147
Domain Number 1 Region: 2970-3054
Classification Level Classification E-value
Superfamily Immunoglobulin 2.22e-23
Family I set domains 0.0056
Further Details:      
 
Domain Number 2 Region: 4059-4153
Classification Level Classification E-value
Superfamily Immunoglobulin 5.34e-23
Family I set domains 0.0087
Further Details:      
 
Domain Number 3 Region: 2382-2479
Classification Level Classification E-value
Superfamily Immunoglobulin 9.62e-23
Family I set domains 0.0085
Further Details:      
 
Domain Number 4 Region: 2863-2961
Classification Level Classification E-value
Superfamily Immunoglobulin 1.8e-22
Family I set domains 0.019
Further Details:      
 
Domain Number 5 Region: 3608-3701
Classification Level Classification E-value
Superfamily Immunoglobulin 2.21e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 6 Region: 508-606
Classification Level Classification E-value
Superfamily Immunoglobulin 2.62e-22
Family I set domains 0.014
Further Details:      
 
Domain Number 7 Region: 2780-2867
Classification Level Classification E-value
Superfamily Immunoglobulin 6.31e-22
Family I set domains 0.0048
Further Details:      
 
Domain Number 8 Region: 2489-2575
Classification Level Classification E-value
Superfamily Immunoglobulin 8.53e-22
Family I set domains 0.021
Further Details:      
 
Domain Number 9 Region: 3142-3243
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 10 Region: 2192-2292
Classification Level Classification E-value
Superfamily Immunoglobulin 4.03e-21
Family I set domains 0.0058
Further Details:      
 
Domain Number 11 Region: 1448-1544
Classification Level Classification E-value
Superfamily Immunoglobulin 4.16e-21
Family I set domains 0.022
Further Details:      
 
Domain Number 12 Region: 698-745,829-888
Classification Level Classification E-value
Superfamily Immunoglobulin 4.18e-21
Family I set domains 0.023
Further Details:      
 
Domain Number 13 Region: 3420-3518
Classification Level Classification E-value
Superfamily Immunoglobulin 7.43e-21
Family I set domains 0.0098
Further Details:      
 
Domain Number 14 Region: 3255-3336
Classification Level Classification E-value
Superfamily Immunoglobulin 1.05e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 15 Region: 2010-2105
Classification Level Classification E-value
Superfamily Immunoglobulin 1.87e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 16 Region: 426-521
Classification Level Classification E-value
Superfamily Immunoglobulin 7.62e-20
Family I set domains 0.03
Further Details:      
 
Domain Number 17 Region: 2586-2672
Classification Level Classification E-value
Superfamily Immunoglobulin 9.82e-20
Family I set domains 0.0087
Further Details:      
 
Domain Number 18 Region: 884-980
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-19
Family I set domains 0.013
Further Details:      
 
Domain Number 19 Region: 3326-3423
Classification Level Classification E-value
Superfamily Immunoglobulin 3.01e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 20 Region: 4142-4240
Classification Level Classification E-value
Superfamily Immunoglobulin 3.06e-19
Family I set domains 0.02
Further Details:      
 
Domain Number 21 Region: 2689-2773
Classification Level Classification E-value
Superfamily Immunoglobulin 3.16e-19
Family I set domains 0.02
Further Details:      
 
Domain Number 22 Region: 1258-1355
Classification Level Classification E-value
Superfamily Immunoglobulin 4.19e-19
Family I set domains 0.0062
Further Details:      
 
Domain Number 23 Region: 2098-2198
Classification Level Classification E-value
Superfamily Immunoglobulin 1.05e-18
Family I set domains 0.018
Further Details:      
 
Domain Number 24 Region: 607-700
Classification Level Classification E-value
Superfamily Immunoglobulin 1.14e-18
Family I set domains 0.012
Further Details:      
 
Domain Number 25 Region: 2298-2386
Classification Level Classification E-value
Superfamily Immunoglobulin 2.15e-18
Family I set domains 0.012
Further Details:      
 
Domain Number 26 Region: 3047-3148
Classification Level Classification E-value
Superfamily Immunoglobulin 3.09e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 27 Region: 3790-3884
Classification Level Classification E-value
Superfamily Immunoglobulin 7.45e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 28 Region: 1366-1452
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 29 Region: 3875-3967
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 30 Region: 3506-3605
Classification Level Classification E-value
Superfamily Immunoglobulin 2.01e-17
Family I set domains 0.057
Further Details:      
 
Domain Number 31 Region: 1916-2013
Classification Level Classification E-value
Superfamily Immunoglobulin 3.04e-17
Family I set domains 0.016
Further Details:      
 
Domain Number 32 Region: 3695-3794
Classification Level Classification E-value
Superfamily Immunoglobulin 1.65e-16
Family I set domains 0.0092
Further Details:      
 
Domain Number 33 Region: 1537-1639
Classification Level Classification E-value
Superfamily Immunoglobulin 2.42e-16
Family I set domains 0.02
Further Details:      
 
Domain Number 34 Region: 3-125
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000333
Family Integrin A (or I) domain 0.027
Further Details:      
 
Domain Number 35 Region: 340-428
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000017
Family I set domains 0.031
Further Details:      
 
Domain Number 36 Region: 4237-4299
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000237
Family I set domains 0.043
Further Details:      
 
Domain Number 37 Region: 990-1066
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000378
Family I set domains 0.012
Further Details:      
 
Domain Number 38 Region: 1662-1726
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000197
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021147   Gene: ENSECAG00000023231   Transcript: ENSECAT00000025419
Sequence length 4300
Comment pep:known chromosome:EquCab2:25:33063947:33167737:1 gene:ENSECAG00000023231 transcript:ENSECAT00000025419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVTLTADPAVFQRELRNLNVQGGGDCPEMSVGAIKAAVEVANPRSFIYVFSDARAKDYHK
KEALLRLLQLKQSQVVFVLTGDCGDRSHPGYLVYEEIAAASSGQVFHLDKQQVTEVLKWV
ESAVQASKVHLLSTDHEEEGEHTWKIPLDPSLKEVTISLSGPGPQIEVRDPLGTILQKDE
GLNVLLSIPDSARVVAFKPEHPGLWSIKVYSSGRHSVRITGISNIDFRAGFSTRPSLDLN
HTIEWPLQGVPISLVINSTGLQAPGRVDSVELSHSSGRPLLTLPTRPLSNGSAHQLWGGP
PFHAPRERFYLKLKGKTRRNPLLRVSGVSYSGVSPGAPLVSMPPRIHGYLHQPLLVSCSV
HSALPFRLQLRRDGTRLGEERHFQESGNSSWEIPRASKAEEGAYECTAVSRAGVGRAKAQ
LVVTEPPPQLLPASNVTVSPGETAILSCQVLGEAPYNLTWIRDWRVLSASTGRVTQLANL
SLEISGTIPSDGGRYQCMASNANGVTRASVWLLVREAPQVSIHTGSQHFSQGTEVRVSCS
ASGYPAPRVSWSHKGRTLQEDSRIRVDAQGTLIIQGVAPEDAGDYSCQAANEVGTDEETV
TLYYTDAPSISAVNAVVLAAVGEEALLACEASGVPPPRVIWYRGTMLLRCRTLSSLRPSS
GTLRIPAVQERDAGVYTCRAVNELGDASAEIRLVVGHAPQLMELPRDVTVELGRSALLAC
RATGRPPPRVTWRRRDGRPLGPGQGSRTGQPDSGVLSFERPRAPALTTGRADTGSHFGWC
DSAQAMTVWLSFCSHCAGPSPVVQTLVQSRQRAPPSTWLGSGILPWSRWPWEWGQALQGL
RHSVRADGSLHLDQALQEDAGRYSCVVTNTAGSQHRDVMLVVQVPPRIQPTATHHVTNEG
VPASLPCVASGVPTPTITWTKETNALTPRDPHYNVSKDGTLVIAQPSARDAGAYVCTATN
AVGFSSQEMRLSVNTQPRILVNGSHDADEPLRITAKAGDDVTLDCEAQGSPPPLVTWTKD
SRPVPPTTDSHKFLPSCCSRSLRTYFDERGLWLCVRGSAAGRHTESSVVDGHPSSVARAP
GEASAGLGLSVFLPFTERLSDLPNLTQQAHGSTRLDPGGHHKGLWAGSFSLEAAGGASNG
ASCPLGRQKQAQDEEQSLRAGRAVGMEDIRPQHSYCLQQMAQDTCPRLPCSSHSRVAPGL
REFSPARLPGHTDPGVGPHSRGALSWMFPSWWFSNGEHVCSRVGEAGGSSSASPCSEVPP
SIREDRRRTNVSGMAGQSLTLECDANGFPAPEIVWLKDGQLIPKVGSHRLLDGARALHFP
RIQEGDSGLYSCRAENQAGAAQRDFDLLVLIPPSMLGSGAGAAREVLGLAGADVELECRP
SGVPTPQVEWTKDGQPVLLGDPHVQLKEDSQVLRITNSHLGDEGEYQCLAFSPAGQQAKD
FQLRIHSPPTIWGSNETSEVAVMEGHPVRFLCEARGVPTPDITWSKDGAPLPHGTEAIYT
RGGRQLQLGRARGSDAGLYTCKASNPAGVVEKATRLEVYVPPTIQGAGGGPYMVKAVAGR
PLALECMARGHPPPTLSWYHKGLPVVESNETWLEAGGGTLGLESPGEAAGGLYSCVASSP
AGEAVLQYVVEVQGEPGLPGWPVTLPWVVLEGLLEEGPFVGGLEGPPGLWLQNGRPAEEL
AGVQVASQGTSLHIEHVELGHAGLFACQATNEAGTAGAEVELAVHALGTLRGQGLYNIVK
FQLYVIICQLPCRCAPSPFMLTPPTPSPLVTTKQFSLSVQASGGVELWAAATDRTDSGAF
SPAEDTVVRYLPKVLFHYHPPSPEAAETWGIQEIVRRLRAWSLQNNERRARVVLVARWRL
ERSLPGVLSLVSPHHPHDNDLMLARRPEFNLWLCAPVGVPSQGPFLLHLQRASALPPRIT
LPPSLPGPVLLDAPVRLTCNATGAPSPLLLWLKDGNPVSTAGTSGLQVFPGGRILSLARA
RAADSGSYSCVAVNAVGEDRRDVVLHVHTPPSILGEELNVSVVANESVALECQSHAVPPP
VLSWRKDGRPLEPGPGVRLSADKALLEVDRAQVRDAGRYTCEALNPAGRSQKHYNLDIWV
PPVFPSREPRTLTVTEGHPARLSCECRGVPFPKISWRKDGLPAGTGGGGRPRGLRPREQV
QVTEAQRAQEGTYTCECSNVAGNSSQDQRLEVHVPPQIAGPREPPTQVSVIQDSEATLEC
NATGKPPPRVTWQRDERPVRPEPGLRLQNRGQRLLVERARAAHAGRYSCVAKNTAGRAER
QFTLSVLVPPELIGDMDPLTNVTVALHSPLTLLCEATGIPPPGVRWFRGEEPLSPREDTY
LLAGGWMLKRTRAQERDRGPYACLASNEAGEVRRNFSVEVLVPPSIEKEDLEEAIKVPEG
QTAHLTCNATGHPQPKVTWFKDGRPLAGEDTHHVSPDGALLQVLQANLSHAGRYSCIAAN
AAGEKTKHFQLSVLVVPTILGVSEDSADEEVTVTVNNPISLICEALAFPSPTITWMKDGA
PFEASNNIQLLPGTHGLQILNAQEEDAGQYTCVVTNELGEAVKNYHVEVLIPPSISKDDP
SGEVGMKEVKTKVNSTLTLECECRAAPPPSISWYKDGQPVTPNPLRVLGEGRLLQIQPTQ
ASDSGRYLCVATNVAGEDDQDFHVLIQVPPMFQKMGDAKARGEVTEYREIVENNPAYLYC
DTNAVPPPELTWYREDQPLSATDGVSVLQGGRVLQIPLVRAEDAGRYSCKASNEVGEDWL
HYELMVLTPPVILGDTEELVEEVTVNASSTVTLQCPALGNPVPTISWLQNGLPFSPSPRL
QVLEDGQVLQVSTAEVADAASYMCVAENLAGSAEKLFTLRVQVPPRITGLNSEQVTAILN
SSVSLPCDVHAHPSPEVTWYKDSRALSLGGEVFLLPGTHTLQLSRAQPSDSGTYVCEALN
AAGRDQKLVQLSVLVPPTFRQAPRGSQDAVLVRAGDKAILSCETDSFPEPTVTWYKDGQP
LVLAQRTQTLLGGQRLEILNTQVSDKGLYSCKVSNTAGEAMWTFVLTVQVPPTFENPRTE
MVSQVAGSPLVLTCDVTGVPAPAVTWLKDRLPIGECSSVAHGVVSRGGRLQLSRLQPTQA
GTYTCVAKNAQAEARKDFVVAVLVAPRIQSSGATQEHNILEGQDVQLDCEADGQPPPEVA
WLKDGAPLGQGVGPHLRFYLDSGSLVLKGLRASDSGAYTCVARNAAGEDARLHTVSVLVP
PTIEQGAEGAGTLVSRTGELVTMACPVRGSPPIRMSWLKNGLPLPLSQRTHLHSSGRTLR
ISQVQLADSGIFTCVAVSPAGVADRNFTLQVHEPPVLEPVEFQNDVAVVRGSPVLLPCEA
RGNPLPLVSWMKDGEPLLSQSLEQGPGLLLESAEAGDSGSYSCVAVSEAGEARRHFQLTV
MDPPYIEDSGQPAELSLTLGAPLELRCNARGTPPPNVTWHKDGQALSRPEDSSRAGRVLR
VEGVQVGDAGLYTCLAQNPAGEAEKSFRVRVQAPPNIIGPQGPRFVVGLAPGQLVLECSV
EGDPAPEIEWHRDGVLLQADAHTQFPERGRFLQLQALSTADSGNYSCTAHNAAGSTSVAF
RVEIHTVPTIRPGPPTVNASVNQTALLPCQVDGAPPPLVSWRKDGAPLDPGSPRLQVLPE
GSLRIQPVLAQDAGHYLCLASNSAGSDRQGRELRVFEPPAIAPSPSNLTLTAHTPALLPC
EASGSPRPLAVWWKDGQKLDLHPQQGAYRLLPSNALLLAAPGPQDAARFECVVSNEAGEA
RRLYQVTVHVPPTIADDQTDFTVTKMAPVVLTCHSTGVPAPVVSWSKAGTQLGVRGSGYR
VSPAGALEIRQALPIHTGRYTCTAHNSAGVAHKHVVLTVQASPVVKPLPSVVRAVAEEEV
LLPCEASGIPRPSIAWQKEGLSVPAGVNAQILPSGQLRIVRAGPEDAGNYFCIAQNSAGS
AVGKTRLADEVGPSELGASRPLRAAPSPSRLWSWAHTSLCPPPTPARPVVLEGIRKKTLA
SDSHCDPLASSGPSWDTSPVTPHSFWLSSSKNHFCPFIPPVIETGLPDLSATEGSHALLP
CTARGSPKPDITWEKDGQPVSGTEEKFTIQPSGELLVKNSESRDAGTYTCTAENPVGRAH
RRVHLTILALPVFTTLPGDCSLRLGDRLWLHCAARGSPTPRLGWTVNGRPVTEGVSEQDG
DSTLQREAATREDSGTYVCWAENTVGRVQAVSFVHVKEAPVLKGEAFSYLVAPVGGSVRL
DCVVLGDPAPDIRWIKDGLPLQGSHLRHRLQNGSLTIHRT
Download sequence
Identical sequences F7C3F9
9796.ENSECAP00000021147 ENSECAP00000021147 ENSECAP00000021147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]