SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021268 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021268
Domain Number 1 Region: 143-460
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.1e-119
Family Transglutaminase core 0.0000000000895
Further Details:      
 
Domain Number 2 Region: 2-140
Classification Level Classification E-value
Superfamily E set domains 2.03e-41
Family Transglutaminase N-terminal domain 0.00000761
Further Details:      
 
Domain Number 3 Region: 483-595
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.06e-30
Family Transglutaminase, two C-terminal domains 0.00000267
Further Details:      
 
Domain Number 4 Region: 595-693
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.44e-26
Family Transglutaminase, two C-terminal domains 0.00000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021268   Gene: ENSECAG00000023860   Transcript: ENSECAT00000025564
Sequence length 694
Comment pep:known chromosome:EquCab2:22:20308216:20347901:-1 gene:ENSECAG00000023860 transcript:ENSECAT00000025564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALEPQSINWQMTSNRRAHNTHNFYDQELILRRGQAFNFLLSLNRNLSSGERLGFIAST
GPNASESAKTKAVFPLSNSGSGGGWSAQLVSSQDKVLTISILTPANAPIGLYTLNLQIFS
HGKEFTLKLGTFILLFNPWLQADSVFMSNRAEREEYVQEDAGIIYVGSANRIGMMGWNFG
QFEEGILNISLAVLDHSLNFRRDPATDVARRSDPKYVGRVLSAMINGNDDNGVISGNWSG
DYSGGRDPRNWNGSVEILKAWKSSGFRPVRFGQCWVFAGTLNTVLRSLGIPARVITNFNS
AHDTDGNLSVDVYYDPMGNPLDKGRDSVWNFHVWNEAWFVRTDLGPSYNGWQVLDATPQE
RSQGVFQCGPASVFGVREGDVDKDFDMPFVFAEVNADRITWIYDAYTGTQKQSSSDSRSV
GKYISTKAVGSSSRVDVTEKYKYPEGSSQERQVFGKALGKLKPRVSFGATSAGSVESEEQ
TPSISGTFKVAGILEVGREVNLALLLKNLTDDVKTVSVNMTAWTIVYNGTLIHEVWKDSV
TISLDPKEEKRHPVKISYAQYEKYLKADNMIRTTAVCQVTDEPEVVVERDVILDNPTLTL
EVLDEVRVQKPVHVQMLFSNPLDEPVKNCVLLVEGSGLLLGSLKIDVPALRPKERSRVRF
EILPTRSGTKQLLADFSCDKFPAIKAMLSIDVAE
Download sequence
Identical sequences F6YMM5
ENSECAP00000021268 9796.ENSECAP00000021268 ENSECAP00000021268 XP_001497639.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]