SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021501 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000021501
Domain Number - Region: 5-65
Classification Level Classification E-value
Superfamily E set domains 0.000182
Family Filamin repeat (rod domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021501   Gene: ENSECAG00000024022   Transcript: ENSECAT00000025826
Sequence length 441
Comment pep:known chromosome:EquCab2:7:17541983:17553973:-1 gene:ENSECAG00000024022 transcript:ENSECAT00000025826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQTLFKVVIKSLSPKELVRIHIPKPLDRNDGTFLMRYRMYETVNEGLKIEVLYGDEHVAQ
SPYILKGPVYHEYCECPEEDPQAWQKTLSCPTKEPQIAKDFASFPSINLQQMLNEVPKRF
GDERGAIVHYTILNNHIYRRSLGKYTDFKMFSDEILLSLARKVLLPDLEFYVNLGDWPLE
HRKVNETPGPLPIISWCGSLDSRDVILPTYDITHSTLEAMRGVTNDLLSIQGNTGPSWIN
KTEKAFFRGRDSREERLQLVQLAKENPQLLDAGITGYFFFQEKEKELGKAKLIGFFDFFK
YKYQVNVDGTVAAYRYPYLMLGDSLVLKQDSPYYEHFYLALKPWKHYVPIKRNLSDLLEK
VKWAKENDGEAKKIAKEGQLTARELLQPHRLYCYYYRVLQKYAERQSSKPEIRDGMELVP
QPKDNESICQCHRKRPLREEL
Download sequence
Identical sequences F6YCH6
ENSECAP00000021501 ENSECAP00000021501 9796.ENSECAP00000021501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]