SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021609 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021609
Domain Number 1 Region: 29-347
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.5e-96
Family Glycosyl hydrolases family 35 catalytic domain 0.0000718
Further Details:      
 
Domain Number 2 Region: 462-598
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.46e-24
Family Beta-galactosidase LacA, domains 4 and 5 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021609   Gene: ENSECAG00000024089   Transcript: ENSECAT00000025947
Sequence length 607
Comment pep:known chromosome:EquCab2:7:42543623:42606641:1 gene:ENSECAG00000024089 transcript:ENSECAT00000025947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRFIWSRLTPLELRNRSMGLQTESRVGSNPYFTLEGHKFLIFGGSIHYFRVPREYWRDRL
LKLKACGFNTVTTYVPWNLHEPERGRFDFSGNLDLEAFVLTAAEIGLWVILRPGPYICSE
IDLGGLPSRLLQDPQVNLRTTDKGFVEAVDKYFDHLISRVVHLQYRKGGPIIAVQVENEY
GSFYKDKDYMPYLQQALLKRGIVELLLTSDNVDDVLKGYIKGVLATINMKKFRKDAFQHL
YKVQRDKPIMIMEYWVGWFDTWGSKHEVKDAGDVKNTVSEFIKFEISFNVYMFHGGTNFG
FINGAINFVKHAGVVTSYGKYYDAVLTEAGDYTKKYFKLRKLFGSILAVPLPPLPELTPK
AVYPSTRSSHYLPLWDVLQYLDEPVMSKMPVSMENLPINNGNGQSYGLVLYETPICSGGQ
LHAHVRDVAQVFLNETTIGILDDSIRNLKIPEVKECQLLRILVENQGRVNFSWKIQNQQK
GLTGPVTINNISLEGFTIYSLEMKMSFFKRLRYVPWRPVPNSYSGPAFYRATLRAGSSPK
DTFLRLLNWNYGFVFINGRNLGRYWIIGPQETLYLPGAWLHPEDNEIILFEKIKSGSVIE
TTDQPVL
Download sequence
Identical sequences F6XAK2
ENSECAP00000021609 9796.ENSECAP00000021609 ENSECAP00000021609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]