SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021660 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021660
Domain Number 1 Region: 597-888
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.74e-80
Family Protein kinases, catalytic subunit 0.0000000399
Further Details:      
 
Domain Number 2 Region: 2-175
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.96e-56
Family Ephrin receptor ligand binding domain 0.0000152
Further Details:      
 
Domain Number 3 Region: 305-510
Classification Level Classification E-value
Superfamily Fibronectin type III 2.04e-21
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 4 Region: 881-948
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.02e-19
Family SAM (sterile alpha motif) domain 0.001
Further Details:      
 
Domain Number 5 Region: 221-300,343-349
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000224
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021660   Gene: ENSECAG00000023882   Transcript: ENSECAT00000026000
Sequence length 949
Comment pep:known chromosome:EquCab2:4:96423415:96437997:-1 gene:ENSECAG00000023882 transcript:ENSECAT00000026000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTLMDTSTAQGELGWLLDPPEDGWSEVQQMLNGTPLYMYQDCPVQEGGDTDHWLRSNWIY
RGEEASRVHVELQFTVRDCKSFPGGARPLGCKETFNLLYMESDQDVGIQLRRPLFQKVTT
VAADQSFTIRDLASGSVKLNVEHCSLGLLTRRGLYLAFHNPGACVALVSVRVFYQRCPEA
VHGLAQFPDTLPRLGGLVEVAGTCLPHAQASPGPSGAARMHCSPDGEWLVPVGRCHCEPG
YEEGGDGEGCLACPGGSYRADMGAPHCLQCPQHSTAETEGATICTCEDGHYRAPGEGPQA
ACTRPPSAPQNLSFSVLGTKLSLSWQPPADTGGRQDVRYSVGCSQCRGAALDGGPCQPCG
GSVRFSPSADGLAAPAVRVDGLEPYANYTFNIAAQNGVSGLDTSKPASALLSISMGHAES
LSGLSLRLVKKEPRQLELTWAGSWPRSPGGNLSYELHVLNQDEERHQMVLEPRVLLTELQ
PDTTYIVRVRMLTPLGPGPFSPDQEFRTSPPVSRSLTGGEIVAVIFGLLLGVGLLLGILV
FRSRKSKRRRQQRPRDHVTSVNREDKLWLKPYVDLQAYEDPAQGALDFTQELDPTWLIVD
TVIGEGEFGEVYRGTLRIPSQDCKTVAIKTLKDTSPDGQWWNFLREATIMGQFNHPHILH
LEGVITKRKPIMIITEFMENGALDAFLREREDQLIPGQLVAMLQGIASGMNYLSDHNYVH
RDLAARNILVSQNLCCKVSDFGLTRFLDNSDGTYETQGGKIPIRWTAPEAIAHRIFTTAS
DVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSIEDGYRLPPPVDCPAPLYELMKNCWAYDR
ARRPHFHQLKAHLDHLLANPHSLRTIANFDPRVTLRLPSLSGSDGIPYRSVPEWLESIRM
KRYILHFHSAGLDTMECVLELTAEDLVQMGITLPGHQKRILCSIQGFKD
Download sequence
Identical sequences F6WYP6
ENSECAP00000021660 ENSECAP00000021660 9796.ENSECAP00000021660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]