SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021684 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021684
Domain Number 1 Region: 249-495
Classification Level Classification E-value
Superfamily Kelch motif 3.66e-34
Family Kelch motif 0.011
Further Details:      
 
Domain Number 2 Region: 428-628
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 2.62e-18
Family Galactose oxidase, central domain 0.033
Further Details:      
 
Domain Number 3 Region: 17-156
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.45e-17
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021684   Gene: ENSECAG00000024078   Transcript: ENSECAT00000026029
Sequence length 735
Comment pep:known chromosome:EquCab2:4:85681270:85845167:1 gene:ENSECAG00000024078 transcript:ENSECAT00000026029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGAVAAAPECRLLPYALHKWSSFSSTYLPENILVDKPNDQSSRWSSESNYPPQYLIL
KLERPAIVQNITFGKYEKTHVCNLKKFKVFGGMNEENMTELLSSGLKNDYNKETFTLKHK
IDEQMFPCRFIKIVPLLSWGPSFNFSIWYVELSGIDDPDVVQPCLNWYSKYREQEAIRLC
LKHFRQHNYTEAFESLQKKTKIALEHPMLTDLHDKLVLKGDFDACEELIEKAVNDGLFNQ
YISQQEYKPRWSQIIPKSTKGDGEDNRPGMRGGHQMVIDVQTETVYLFGGWDGTQDLADF
WAYSVKENQWTCISRDTEKEAIPHARSCHKMCIDIQRRQIYTLGRYLDSSVRNSKSLKSD
FYRYDIDTNTWMLLSEDTAADGGPKLVFDHQMCMDSEKHMIYTFGGRILTCNGSVDDSRA
SEPQFSGLFAFNCQCQTWKLLREDSCNAGPEDIQSRIGHCMLFHSKNRCLYVFGGQRSKT
YLNDFFSYDVDSDHVDIISDGTKKDSGMVPMTGFTQRATIDPELNEIHVLSGLSKDKEKR
EENVRNSFWIYDIVRNSWSCVYKNDQAAKDNPSKSLQEEEPCPRFAHQLVYDELHKVHYL
FGGNPGKSCSPKMRLDDFWSLKLCRPSKDYLLRHCKYLIRKHRFEEKAQMDPLSALKYLQ
NDLYITVDHSDPEETKEFQLLASALFKSGSDFTALGFSDVDHTYAQRTQLFDTLVNFFPD
SMTPPKGNLVDLITL
Download sequence
Identical sequences F6WRT5
ENSECAP00000021684 ENSECAP00000021684 9796.ENSECAP00000021684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]