SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021773 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021773
Domain Number 1 Region: 408-738
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000531
Family Rhodopsin-like 0.024
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000021773
Domain Number - Region: 51-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0145
Family Integrin beta EGF-like domains 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021773   Gene: ENSECAG00000024222   Transcript: ENSECAT00000026128
Sequence length 793
Comment pep:known chromosome:EquCab2:19:54649540:54704406:-1 gene:ENSECAG00000024222 transcript:ENSECAT00000026128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFCRVCDLKVLVAIVCGLLTAIVLGLGIWRIAVRIHRGTTIPTSSTPIAFCRNGGTWDN
GRCICPEDWKGLRCTVANFCENSTYKSFTFPRISVGRYGPSFQTCDNSTLNAGNPMATRL
CSLNENGEIELQNVTIGNCNENLETLEQQIGNTSIPFSNISMEVQILTSNASKLTPENIT
SATRVLGQIFNTSRNDSSEAKLVAVTTVSQLLDASEDIFQEAAATDDAAFETLIEQIETY
SLSLGSEPVVKPNIAIQSGDIPSEGSTGVLFTVQKGASESLISGSTSISTSADGLNADEQ
TELQVFLNTSASNAKSCGFVVYQNSKLFQSKTFTTTSNFSQKIVSSTIDANKEDQSSSVT
MVFNPKNNQQGFQLHSYACVYWNLSKKDWDTYGCHKEEGLDGFLGCHCNHTTSFAVLMSF
KKYHKYPESLDILSILGCALSITGLAVTIIFQIVTRKVRKTSITWVLVSLCTSMLIFNLL
FVSGIENPNKNSETSGSVSTVDSNNNEIPRQDIVFSSNPTCTVFAALLHYFLLGTFMWTG
LSAAQLYFLLIRTMKPLPPRFILFISLIGWGVPAVVVALTVGIIFSQYKDDPEWELHYRQ
EQICWLAVPESTGLLASPLLWAFIVPVTIILISNIVIFVIIVVKVLWKNNQNLTSTKKSS
SLKKILSTLSIAVVLGITWILSYLMLIEDDDIRIIFSYIFCLFNTTQGLQIFIVYTVRTK
IFQSEASKVLKSLSSSTGTVKSLPPMIPLRLRVRMYNMLRSLPALNERFRLLEPSLVNNE
TTLSESDQENPSI
Download sequence
Identical sequences F6YF06
XP_001502196.1.31192 XP_008515724.1.77740 9796.ENSECAP00000021773 ENSECAP00000021773 ENSECAP00000021773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]