SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021799 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021799
Domain Number 1 Region: 704-1002
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 7.33e-89
Family Complement components 0.0000299
Further Details:      
 
Domain Number 2 Region: 533-653
Classification Level Classification E-value
Superfamily E set domains 1.06e-34
Family SVA-like 0.006
Further Details:      
 
Domain Number 3 Region: 1075-1179
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 3.14e-24
Family Alpha-macroglobulin receptor domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021799   Gene: ENSECAG00000024232   Transcript: ENSECAT00000026158
Sequence length 1185
Comment pep:known chromosome:EquCab2:6:35926751:35962550:1 gene:ENSECAG00000024232 transcript:ENSECAT00000026158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGAVQVSACQKAHNYWFPKAEEEQLLDNCRNISGQTDKAGCFSASVDMSTFNLTSYRYS
HRINIVATVVEEGTGVEANTTQEIDISSQMGSMSFEDTNNFYHPNFPFSGKIRVRGRDGS
LLKSHSVFLVIKGINGTTNQTLITDNDGLAPFQLDTITWNGTDISLEGRFQMEDLEYKPE
QVHHYYQNAYLYLRPFYNTTRSFVGIRPLSGILECGQPQEVLVDYYIDPDDVNPDQEVIF
SYYLTGKGNLEMEGQKHLNSKKKGLKGSFSLSLTFSSRLAPDPSLVIYAIFPTGGVIADK
VQFSVELCFDNQVSLGFSSSQQLPGAEVELQLQAAPGSLCAVRAVDESVLLLRLERELSN
SSVYGIFPFRHGYYPYQVAEHDECPASGPWDFPQPLIRPMSVGRWSEHPIIWRPWFTEGT
DLFGFFQDMGLKILSNAKIKKPVDCSYWSPEYSMVTGGVRPVAFESSSSSLQSEDSQVRQ
YFPETWLWELFPIGNSGKEAVHVTVPDTITEWKAMTFCTSQSSGFGLSPTMGLTAFKPFF
VDLTLPYSVVRGESFRLTATIFNYLKNCIRVQTNLAKSDEYQVESWTDSQASSCLCADEA
KTYHWNITAVKLGHVNFTISTKILDSNELCGGQKGFVPEKGRSDTLIKPVLVKPEGVLVE
KTHSSLLCPKGKVASESISLEIPVDVVPDSTKAYVTVLGDIMGTALKNLDNLVQMPSGCG
EQNMVLFAPIIYVLQYLQKSGLLTEEIRSRAVGFLEIGYQKELMYKHSNGSYSAFGEQDG
NGNTWLTAFVTKCFGQAREFIFIDDKNIQDALEWMAGNQLPSGCYANVGKLLHTAMKGGV
DDETSLAAYITAALLEMGQTPDDPMVSRGLQCLKNSVSSTTSLYTQALLAYTFSLAGEMD
IRNILLEKLDQQAIISGESIHWSQKPTPSSNASPWSQPQAVDVELTAYILLAWLSKSSLT
QKEIAKATGIVAWLAKQRNAYGGFSSTQDTVVALQALAKYASTAYKPSEEVSLAVKSTEN
FQRTFNVRAANRLVFQQETLPNVPGVYTLEASGQGCIYVQTVLRYNILPPKNVETFDLSV
EIGKAKCELSTSPRSLTLTVHTSYVGSRSSSNMAIVEVKMLSGFSPMDGTNQLLLQQPLV
KKVESGTDTLNIYLEELSKKTQSYTFTISQSVLVTNLKSSNRQGL
Download sequence
Identical sequences F6YA47
9796.ENSECAP00000021799 ENSECAP00000021799 ENSECAP00000021799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]