SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022004 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022004
Domain Number 1 Region: 1836-1960
Classification Level Classification E-value
Superfamily CalX-like 6.15e-22
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1722-1836
Classification Level Classification E-value
Superfamily CalX-like 7.59e-22
Family CalX-beta domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1963-2077
Classification Level Classification E-value
Superfamily CalX-like 4.97e-19
Family CalX-beta domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022004   Gene: ENSECAG00000024518   Transcript: ENSECAT00000026386
Sequence length 2086
Comment pep:known chromosome:EquCab2:2:88330910:88414386:1 gene:ENSECAG00000024518 transcript:ENSECAT00000026386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHLPTWGALGCSSRDGPSVLIANPVLRVPVGRSLWLDPLRDLVIRVQPGDRCEVTVLDAL
PLHHGALSPRRFPCAFGPRQVRYTHFGSRSPGRGRVRLQLLCEAPTYTLALRFTVAVVVV
FSHLELVTRNAPLAVEKLRGWSPATDRRVLDFASLDARRCWLIPLPPEGGPLPRYGRLVD
AVGVPLTRGKGIDCEAFVLAGVRYQHTATTPSPNRDYVPMVVELLGREDRGAGSVEVLLP
EHFQLLVRILEGAENTTPKPSFEAVMMMEVDQFLLTALTPDALAAEDMESDPDDLVFNVL
KAPTTTSGHQGYLVSTDDPLGLPVSFFTQRELRELTIAYQPPTEKLDGEHLFQLELEVMD
GDGATSDPFAFMVLVKSMNILAPVASYNRGLLLFEGQSRPLSSAHNLQISDNSNPEELKV
AAVRGLRHGQLVVLGAPAGCKHFPPVDLAAGRVVYQHDGSDTYSDNIIFQMKDWHNHVEF
LFPVTIIPVDDEPPMVSANTGLSVTEGQVVQISPFVLSATDIDSEDSTICFVLEDQPLEE
KEEERGWDLAAGSSHSSQLLGEMLLRQVEPPLSSEEEDWHYVGKEGLYETVVTEWLQRDI
MEGKVFYHHLGPHSPQSVMTQLTFHVQDDHDPPNLSKQHFFTIKFQPVDLQSPELFPGTT
LEMTVQEYQLTHFQKKFLQYIDQDSDDQNLWYTLLTPPTDTDGNHPVQAGDIVLTDSPDT
PIVHFTQAQMNHHKVAYQPPQKKLGIVPRVVQFTYQVKDAAGNSITGTFTLFLKPVDNQP
PVVTNRGFTVLEGESFILSSNELDVTDPDTDIDQIVFMLVWGPQHGHLQYLKKCMVLGES
FRQADIINGSVSYQHSRDQSTSDTFHLEVSDRVHHVPITVKISVHPTAADRSPRISFTGS
SLLDVSTDVLENRATEITMGIIHGKRKGTRDLMLSFIMENSPQLGTILVNGLPTEQFTQE
DLISGAVVYVHTGGEVGFQKQHDTFSFAVSKGSYQWVVGDSIVERVQVQVIVLPVDNVVP
KVLVREAYIVYEGGKSPLTLEHLNIEDVDTPQDEILCTVTGQPASGYLENIAPAPGSEVS
QAGSPISAFSIRDVQMMHINYIQSIHKGVEPQEDQFIFYCSDGINFSPNIFFPIIILPTN
DEQPELFARKFVVLEGMSLVIDTPLLNGADADLPPNELHFQLTALPRHGRIIRQLATGSQ
PIHSFTLQEIQEASTIVYEHDDSETSEDSFEVWLSDGKHTTHRKVPIVVILVDDETPRLT
INGGLELETGHTAVITNQVLKATDLDSDDKRLSFVLRSGPQQGLLQRLRQPKGEVRNNLT
LGMNFTQDEIDRGLICYTHTGQEGVLDLIKFDVTDGVNHLIDRYFYVTIGSLDRVFLKVI
SKGVTLTEGGRVALTTDLLSTSDINSSDEQLHFSITQAPSLGHLESSDHPGEPIASFTQL
QLAGNKLFYVHTSNDEIKMDSFVFQVTDGHNPVFQTIRIFITDVDNKKPILTIHKLILQE
GESKLITPFELTVEDKDTPDDLLLFSITQVPFHGKILYNGSHPVTTFTKRDLNENLISYW
HNGSETTEDSFSLTVTDGTHADFYVFPDTALETHKPQVMKIHICPLDNRLPQIAVNRGAP
ALKHLHTGHVDFLITNKSLKAEHQDGPHRLLKYKVTRGPEHGFIINTGLGNESTRVFTQA
DIDEMRMHYILNEGSKATEDVFYLSVEDNGGNKLTNQPFLLNWAWISLEKEYYIVDEDSM
FLEVTLTCRGYLGETSFISIVTKDETAKKDKDFKGKAQKQIQFNPGQTTATWRMRIISDN
EYEVSETFQIILLDPVMAALEFPEMATIEIIDPGDESTVHIPEAEYKIEEDVGELLIPVR
RSGDASQELTVVCSTRQGSATGTISSTMLSLSDYVSRPKDHTSTLRFDKDETEKTCQVLI
IDDSLYEEEESFSVSLSLPIGGQLGAKFPSTKVIIQADRDDEPALHFGDAEYHVEESAGS
VEVCVWRTGTDLSQASSVAVRSRRTETASAEAGIDYIGVSRNLDFAPGVRMQIFQVTILD
DPEKPILEGPERFELFLQMPMGAVLGEPNKTTIFINDTITDCEQSA
Download sequence
Identical sequences F6QGV2
ENSECAP00000022004 ENSECAP00000022004 9796.ENSECAP00000022004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]