SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022021 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022021
Domain Number 1 Region: 1312-1420
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-35
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 614-728
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-33
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 3 Region: 1835-1944
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-32
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 4 Region: 1658-1777
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-32
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 5 Region: 450-554
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-31
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 6 Region: 70-172
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-30
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 7 Region: 273-383
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-28
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 8 Region: 1132-1253
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-28
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 9 Region: 965-1074
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 10 Region: 786-907
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.59e-26
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 11 Region: 2007-2114
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.19e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 12 Region: 2187-2291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-25
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 13 Region: 1480-1595
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-23
Family Spermadhesin, CUB domain 0.0058
Further Details:      
 
Domain Number 14 Region: 2565-2633
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-18
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 15 Region: 2921-2992
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.56e-18
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 16 Region: 2805-2872
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.92e-17
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 17 Region: 2622-2689
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.8e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 18 Region: 3102-3170
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.73e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 19 Region: 210-282
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000106
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 20 Region: 2862-2932
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000011
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 1949-2017
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000621
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 22 Region: 2976-3037
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000675
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 23 Region: 2476-2538
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 24 Region: 6-67
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000202
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 25 Region: 1776-1839
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000324
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 26 Region: 2293-2366
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000486
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 27 Region: 2738-2798
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000103
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 28 Region: 2356-2423
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000189
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 29 Region: 734-794
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000195
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 30 Region: 1425-1493
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000243
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 31 Region: 1077-1140
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000264
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 32 Region: 2680-2748
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 33 Region: 1252-1315
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000351
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 34 Region: 388-450
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000445
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 35 Region: 2119-2184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000189
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 36 Region: 1602-1665
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000264
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 37 Region: 559-627
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000473
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 38 Region: 3161-3220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000625
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 39 Region: 2428-2493
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000778
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 40 Region: 907-969
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000998
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022021   Gene: ENSECAG00000024035   Transcript: ENSECAT00000026403
Sequence length 3459
Comment pep:known chromosome:EquCab2:2:23172335:23565432:1 gene:ENSECAG00000024035 transcript:ENSECAT00000026403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLPSHTCGNPGRLPNGVQQGSTFNLGDKVRYSCNPGFFLEGHAVLTCHSGSENSATWDFP
LPSCRADDACGGTLRGQSGIISSPHFPSEYHNNADCTWTILAELGDTIALVFIDFQLEDG
YDFLEVTGTEGSSLWFTGASLPAPVISSKNWLRLHFTSDGNHRQRGFSAQYQVKKQIELK
SRGVKLMPSKDNSQKTSVLTQVGVSQGHNMCPDPGIPERGKRLGSDFRLGSSVQFTCNEG
YDLQGSKRITCMKVSDMFAAWSDHRPVCRARMCDAHLRGPSGIITSPNFPIQYDNNAHCV
WIITALNPAKVIKLAFEEFDLERGYDTLTVGDGGQDGDQKTVLYILTGTSVPDLIVSTNH
QMWLLFQTDGSGSSLGFKASYEEIEQGSCGDPGIPAYGRREGSRFHHGDTLKFECQPAFE
LVGQKAITCQKNNQWSAKKPGCVFSCFFNFTSPSGVVLSPNYPEDYGNHLHCVWLILARP
ESRIHLAFNDIDVEPQFDFLVIKDGATAEAPVLGTFSGNQLPSSITSSGHVARLEFQTDH
STGKRGFNITFTTFRHNECPDPGVPVNGKRFGDSLQLGSSISFLCDEGFLGTQGSETITC
ILKEGSVVWNSAVLRCEAPCGGHLTSPSGTILSPGWPGFYKDALSCAWVIEAQPGYPIKI
TFDRFKTEVNYDTLEVRDGRTYSAPLIGVYHGTQVPQFLISTSNYLYLLFSTDKSHSDIG
FQLRYETITLQSDHCLDPGIPVNGQRHGNDFYVGALVTFTCDSGYTLSDGEPLECEPNFQ
WSRALPSCEALCGGFIQGSSGTILSPGFPDFYPNNLNCTWIIETSHGKGVFFTFHTFHLE
SGHDYLLITENGSFTQPLRQLTGSRLPAPISAGLYGNFTAQVRFISDFSMSYEGFNITFS
EYDLEPCEEPEVPAYSIRKGLQFGVGDTLTFSCFPGYRLEGTARITCLGGRRRLWSSPLP
RCVAECGNSVTGTQGTLLSPNFPVNYSNNHECIYSIQTQPGKGIQLKARAFELSEGDVLK
VYDGNNNSARLLGVFSRSEMMGVTLNSTSSSLWLDFITDAQNTSKGFELQFSSFELIKCE
DPGTPQFGYKVHDGGHFAGSSVSFSCDPGYSLRGSEALLCLSGERRTWDRPLPTCVAECG
GTVRGEVSGQVLSPGYPAPYEHNLNCIWTIEADAGCTIGLHFLVFDTEEVHDVLRIWDGP
VESGVLLKELSGSALPKDLHSTFNSVVLQFSTDFFTSKQGFAIQFSVATATSCNDPGVPQ
NGSRSGDSWEAGDSTVFQCDPGYALQGSAEISCVKIENRFFWQPSPPTCTAPCGGDLTGP
SGVILSPNYPEPYPPGKECDWKVTVSPDYVIALVFNIFNLEPGYDFLHIYDGPDSLSPLI
GSFYGSQLPGRIESSSNSLFLAFRSDASVSNAGFVIDYTENPRESCFDPGSIKNGTRVGS
DLKLGSSITYYCHGGYEVEGSSTLSCILGPDGKPVWNNPRPVCTAPCGGQYVSSDGVVLS
PNYPQNYTSGQICLYFVTVPKDYVVFGQFAFFHTALNDVVEVHDGHSQHSRLLSSLSGSH
TGESLPLATSNQVLIKFSAKGQAPARGFHFVYQAVPRTSATQCSSVPEPRYGKRLGSDFS
VGAVVRFECNSGYALQGSPEIECLPVPGALAQWNVSAPTCVVPCGGNLTERRGTILSPGF
PEPYLNSLNCVWKIMVPEGAGIQIQVISFVTEQNWDSLEVFDGADNTVTMLGSFSGTTVP
ALLNSTSNQLYLHFYSDISVSAAGFHLEYKTVGLSSCPEPAVPSNGVKTGERYLVNDVVS
FQCEPGYALQGHAHISCMPGTVRRWNYPPPLCIAQCGGVVEEMEGVILSPGFPGNYPSNM
DCSWKIALPVGFGAHIQFLNFSTEPNHDFIEIRNGPYETSRVMGRFSGSELPGALLSTSH
ETTVYFHSDHSQNRPGFKLEYQAYELQECPDPEPFANGIVRGAGYNVGQSVTFECLPGYQ
LIGHPVLTCQHGTNRNWDHPLPKCEVPCGGNITSSNGTVYSPGFPSPYSSAQDCVWLITV
PIGQGIRLNLSLLQTEPSGDFITVWDGPQQTAPQLGVFTRSSAKKTVHSSSNQVLLKFHH
DAAMGAIFAMAFSAYPLTKCPPPTILPNAEVVTENEEFNIGDIVRYRCLPGFTLVGSEIL
TCKLGTYLQFEGPPPICEVHCPTNELMTDSTGVILSQSYPGSYPQFQTCSWLVRVEPEFN
ISLTVEYFLSEKQFDEFEIFDGPSGQSPLLKALSGNYSAPLIVTSSSNSVYLRWSSDHAY
NRKGFKIRYSAPYCSLPRAPLHGFLLGQTSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQ
GYFLWSEAIPLCQALSCGLPEAPKSGMVFGREYTVGTKAVYSCSEGYHLEAGAEATAECL
ETGIWSNRNVPPQCVPVTCPDVSSISVEHGRWRLIFETQYQFQAQLMLICDPGYYYTGQR
VIRCQANGKWSLGNSMPTCQIISCGELPIPPNGHRIGTLSVYGATAIFSCNSGYTLVGSR
VRECMANGLWSGSEVRCLGKEVTPHLTFYKLLFDLLSPSLTKAGHCGTPEPIVNGHINGE
NYNYRGSVVYQCNAGFRLIGMSVRICQQDHHWSGKTPFCVPITCGHPGNPINGLTQGNQF
NLNDVVKFVCNPGYVAEGAARSQCLASGQWSDTLPTCRIINCTDPGHQENSIRQVHASGP
HRFSYGTTVSYQCNHGFYVLGTPVLSCQGDGTWDRPRPQCLLVSCGHPGSPPHSQMSGDS
YTVGAVVRYSCTGKRTLVGNATRMCGLDGQWTGSLPHCSGTSMGICGDPGIPAHGIRLGD
SFAPGSLMRFSCEAGHALRGSSERTCQANGSWSGTQPECGVISCGNPGTPSNARVMFSDG
LVFSSSIVYECREGYYATGLLSRHCSVNGTWTGSDPECIVINCGDPGIPANGLRLGNDFR
YNKTVTYQCVPGYMMESHRVSVLSCTKDRTWNGTKPICKAIMCKPPQLIPNGKVVGSDFM
WGSSVTYACLEGYQLSLPAVLTCEGNGSWTGELPQCFLPEDLGDPPHVHSRTYFSPRPQR
STFQIAYSCHIPLLENSPKKIIQVNNTWTLGSQPCTNPTLTMCADPGMPQFGIQNNSQGY
QVGSTVLFRCQKGYLLQGSTTRTCLPNLTWSGTPPDCVPHHCKQPETPTHADVGALDLPS
MGYTLIYSCQEGFSLKGGSEHRTCKADGSWTGKPPVCLEVRPSGRPINTAREPPLTQASV
PGDVFAKNSLWKGAYEYQGKKQPAMLRVTGFQVVNSKVNATMIDHSGVELHLAGTYRKED
FHLLLQVYQTTGPVEIFVNKFKDDHWALDGHVSSESSGGTFVYQGSVKGQGFGQFGFQRL
DLRLLESDPESIGRHFASNSSSVAAAILVPFIALIIAGFVLYLYKHRRRPKVPFNGYAGH
ENTNVRATFENPMYDRNIQPTDIMATEAEFTVSTVCTAV
Download sequence
Identical sequences F6SDJ9
ENSECAP00000022021 ENSECAP00000022021 9796.ENSECAP00000022021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]