SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022135 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022135
Domain Number 1 Region: 1-177
Classification Level Classification E-value
Superfamily E set domains 2.49e-67
Family RhoGDI-like 0.000000546
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022135   Gene: ENSECAG00000024621   Transcript: ENSECAT00000026525
Sequence length 178
Comment pep:known chromosome:EquCab2:13:42319229:42320433:-1 gene:ENSECAG00000024621 transcript:ENSECAT00000026525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRAPGRKSLLEIQQLDPDDQSLAKYKQALLGPLPPVADPSLPNVQVTRLTLMSEQAPGPI
TMDLTGELAALKNQVFILKEGVDYRVKITFKVNKEIVSGLRCLHHTYRQGLRVDKAVYMV
GSYGPSAQEYEFVTPVEEAPRGALVRGAYVVTSFFTDDDRTDHLSWQWGLQICRDWES
Download sequence
Identical sequences F6QPK1
9796.ENSECAP00000022135 ENSECAP00000022135 ENSECAP00000022135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]