SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022159 from Equus caballus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022159
Domain Number 1 Region: 931-1116
Classification Level Classification E-value
Superfamily Fibronectin type III 1.32e-20
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 2 Region: 624-693
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000714
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 718-758
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000113
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 4 Region: 240-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000171
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 5 Region: 315-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000216
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 6 Region: 835-913
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000438
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 7 Region: 549-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000196
Family EGF-type module 0.008
Further Details:      
 
Domain Number 8 Region: 720-831
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000392
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 9 Region: 682-717
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000103
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 10 Region: 1237-1275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000767
Family EGF-type module 0.014
Further Details:      
 
Domain Number 11 Region: 471-583
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000173
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 12 Region: 280-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000712
Family EGF-type module 0.022
Further Details:      
 
Domain Number 13 Region: 201-245
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000804
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 14 Region: 359-388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000042
Family EGF-type module 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000022159
Domain Number - Region: 400-506
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000377
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022159   Gene: ENSECAG00000024612   Transcript: ENSECAT00000026551
Sequence length 1341
Comment pep:known chromosome:EquCab2:6:26391860:26443962:1 gene:ENSECAG00000024612 transcript:ENSECAT00000026551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNNNGIISFLKEVSQFTPVAFPIAKDRCVVAAFWADVDNRRAGDVYYREATDPATLRRAT
EDVRRYFPELPGFSATWAFVATWYRVTFFGGSPSSPVNTFQTVLITDGKFSFTIFNYESI
TWTTGTHASSGGDSSGLGGIAAQAGFNAGDGRRYFSIPGSRTADMAEVETTTNVGVPGRW
AFRIDDAQVRVGGCGHTTSVCLALRPCLNGGKCIDDCVTGNPSYTCSCLSGFTGKRCHLD
VDECASDPCRNGGTCTHGVNSFSCQCPAGFEGPTCETAQSPCDAKECENGGQCQVEGSSA
VCVCQAGYTGAACETDVDECFSGPCLNGGSCVDLVGNFTCLCAEPFEGPRCETGSHTGPD
ACLSAPCQNGGTCVDADQGYVCEWPEAFMVICRERTPDDCECRNGGRCLGANTTLCQCPP
GFFGLLCEFEVTATPCNMNTQCPDGGYCMEYGGSYLCVCHTDHNVSHSLPSPCDSDPCFN
GGSCDAHDDSYTCECPRGFHGRHCEKARPRLCSSAPCRNGGTCKEAGGEYHCSCPFRFTG
RHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCPPGFSGRHCEIGKMAWPRGSSADKKTG
PPRKGGPSCGGQWGDGAAVSLAEVDCGPPEEVKHATLRFNGTRLGSVALYLCDQGYSLSA
PNHRVCQPQGVWSEPPQCHEIDECQSQPCLHGGSCQDHVAGYLCICSAGHEGAHCELETD
ECQAQPCRNGGSCRDLPGAFVCQCPEGFTGVHCEIEVDACDSSPCQHGGRCENGGGAYLC
VCPEGFFGYHCETVSDPCFSNPCGSRGYCLASNGSHSCTCKVGYTGKDCAKELFPPTALK
VERVEESGVSISWRPPEGQAARQMLDGYAVTYASPDGSYRRTDFVDQSRSSHQLRALAAG
RAYNISVFSVKRNANNKNDISRPAVLLTRTRPRPVEGLEVTNVTASAISVRWALHRIRHA
TVSSVRLSIRHPEAQEDQSTDVDRSVDRFTFGALLPGRRYTIWVTALSGLGAQEHPTESL
ASAPLHVWTRPLPPANLTATRVTATSAHVVWDAPTPGTSLEAYVINVTTSQSTKSRYVPN
GRLASYTVRDLMPGRRYQLSVTAVQSAEGDQLHSEPAHLYIITSPRDGADRRWHREGLHP
RVLRNRPPPARLPELRLLNDRGAPETPTQSPRFSELVDGRGRVSARFSGLPSKSVTVRSQ
PTALVQPENAEEAPEQVSLAPQLPERGSDKDMENVPTNCSENPCRNGGTCVPGVDTHSCD
CAPGFKGRRCELACKKVPQPCTRLFSETKSFPVWEGGVCHHVYKKVYKVHQDICFKESCE
STSIRKTPNRKQSNSATLKKS
Download sequence
Identical sequences F6RXB8
ENSECAP00000022159 9796.ENSECAP00000022159 ENSECAP00000022159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]